DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7c and KaiR1D

DIOPT Version :9

Sequence 1:NP_001245572.1 Gene:Ir7c / 31692 FlyBaseID:FBgn0029966 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_650925.1 Gene:KaiR1D / 42473 FlyBaseID:FBgn0038837 Length:853 Species:Drosophila melanogaster


Alignment Length:559 Identity:101/559 - (18%)
Similarity:206/559 - (36%) Gaps:132/559 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 RNGFFLVIYTGLEDQPMESLKIM-FRRLLNMYVLNVNVFLQRDGTVHLYTYYPYGPHHC---QSS 179
            ::||.|:.|          :||: .:.|.|:...:...| :.|..:.:....|.|....   .|:
  Fly   338 QHGFSLINY----------MKIVEMKGLTNVIKFDHQGF-RTDFMLDIVELTPAGIRKIGTWNST 391

  Fly   180 LPVYYTAFQDLAAPANGFGLTKPLFPRKL----TNMHGCEMVVATFEHRPYVIIEDDP-KTPGGR 239
            ||             :|...|: .|.:|.    .|:....:||.|....||.:.::.. ...|..
  Fly   392 LP-------------DGINFTR-TFSQKQQEIEANLKNKTLVVTTILSNPYCMRKESAIPLSGND 442

  Fly   240 SIHGIEGLIFRSLAERMNFTIKLVEQKDKNRGEILPDGNF----------TGILKMMVDGEVNLT 294
            ...|....:...:::.:.|..|:         :::|||::          .|:::.:::...:|.
  Fly   443 QFEGYAVDLIHEISKSLGFNYKI---------QLVPDGSYGSLNKLTGEWNGMIRELLEQRADLA 498

  Fly   295 FVCFMYSKARSDLMLPSTSYTSFPIVLVVPSGGSISPMGRLTRPFRYI------IWSCILVSLIF 353
            ......:..|...:..:|.:.:..:.::..     .|:.:....|.::      :|..:..:.:.
  Fly   499 IADLTITFEREQAVDFTTPFMNLGVSILYR-----KPIKQPPNLFSFLSPLSLDVWIYMATAYLG 558

  Fly   354 GFVLICLL-KITAL--PGLRNLVLGRRNRLPFM---GMW---ASLLGGLALYNPQRNFARYILVM 409
            ..||:.:| |.|..  |...: ..|.:....|.   .||   .||:.....:.|:....|.:..:
  Fly   559 VSVLLFILAKFTPYEWPAYTD-AHGEKVESQFTLLNCMWFAIGSLMQQGCDFLPKALSTRMVAGI 622

  Fly   410 WLLQTLILRAAYTGQLYLLLQDVEMRSPIKSLSEVLAKDYEFRILPALR-----TIFKDSMPTTN 469
            |...|||:.::||..|...|....|.|||:| :|.|||....: ..||:     ..|:||.    
  Fly   623 WWFFTLIMISSYTANLAAFLTVERMDSPIES-AEDLAKQTRIK-YGALKGGSTAAFFRDSK---- 681

  Fly   470 FHAVLSLEESLYRLRDEDDPGITVA------------------LLQPTVNQFDFRSGPNKRH--L 514
                :|..:.::...:...|.:..|                  |::.|..::     ..:|:  |
  Fly   682 ----ISTYQRMWSFMESARPSVFTASNGEGVERVAKGKGSYAFLMESTSIEY-----VTERNCEL 737

  Fly   515 TVLPDPLMTAPLTFYMRPHSYFKRRIDRLIMAMMSSGIVARYRKMYMDRIKRVSKRR-------- 571
            |.:...|.|........|:|.::..|:.:|:.:...|      |:::.:.|...::|        
  Fly   738 TQVGGMLDTKSYGIATPPNSPYRTAINSVILKLQEEG------KLHILKTKWWKEKRGGGKCRVE 796

  Fly   572 ----NLEPKPLSIWRLSGIFVCCAGLYLVALIVFILEIL 606
                :.....|.:..:.|:||...|...||.::.:.|.:
  Fly   797 TSKSSSAANELGLANVGGVFVVLMGGMGVACVIAVCEFV 835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7cNP_001245572.1 Lig_chan-Glu_bd 225..287 CDD:214911 10/72 (14%)
Lig_chan 343..593 CDD:278489 59/295 (20%)
KaiR1DNP_650925.1 PBP1_iGluR_Kainate 31..397 CDD:107377 16/82 (20%)
ANF_receptor 42..378 CDD:279440 10/50 (20%)
Periplasmic_Binding_Protein_Type_2 415..785 CDD:304360 72/405 (18%)
Lig_chan 547..823 CDD:278489 60/297 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.