DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7c and Ir75c

DIOPT Version :9

Sequence 1:NP_001245572.1 Gene:Ir7c / 31692 FlyBaseID:FBgn0029966 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_649013.3 Gene:Ir75c / 39983 FlyBaseID:FBgn0261401 Length:623 Species:Drosophila melanogaster


Alignment Length:397 Identity:79/397 - (19%)
Similarity:146/397 - (36%) Gaps:97/397 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 FTGILKMMVDGEVNLTFVCFMYSKARSDLMLPSTSYTSFPIVLV--VPSGGSISPMGRLTRPFRY 341
            |.|.:.|:.:....|....|:.|..|...:.|.|....|..|.:  .|....|.....| .||..
  Fly   264 FGGAIGMLTNESAELCTTPFVPSWNRLHYLHPMTEQAQFRAVCMFRTPHNAGIKAAVFL-EPFMP 327

  Fly   342 IIWSCILVSLIFGFVLICLL----------KITALPGLRNLVLGRRNRLPFMGMWASLLGGLALY 396
            .:|......|||..||:.::          .:..:|.|.:..|        :...|:.:.|..|.
  Fly   328 SVWFAFAGLLIFAGVLLWMIFHLERHWMQRCLDFIPSLLSSCL--------ISFGAACIQGSYLM 384

  Fly   397 NPQRNFARYILVMWLLQTLILRAAYTGQLYLLLQDVEMRSPIKSLSEVL--AKDYEFRILPALRT 459
             |:....|...:..:|.:.::...||..:...|....:||.|:::.::.  :.|..|..:|..:|
  Fly   385 -PKSAGGRLAFIAVMLTSFLMYNYYTSIVVSTLLGSPVRSNIRTIQQLADSSLDVGFDTVPFTKT 448

  Fly   460 IFKDSMPTTNFHAV---------------LSLEESLYRLRDEDDPGITVALLQPTVNQFDFRSGP 509
             :..|.|..:..::               ||.||.:.|:||:  ||            |.:.|..
  Fly   449 -YLVSSPRPDIRSLYKQKVESKRDPNSVWLSPEEGVIRVRDQ--PG------------FVYTSEA 498

  Fly   510 N-----------KRHLTVLPDPLMTAPLTFYMRPH--SYFKRRIDRLIMAMMSSGIVARYRKMYM 561
            :           .|.::.|.:.::......|...|  |.:::.:.:|.:.|:.:||.::..:.: 
  Fly   499 SFMYHFVEKHYLPREISDLNEIILRPESAVYGMVHLNSTYRQLLTQLQVRMLETGITSKQSRFF- 562

  Fly   562 DRIKRVSKRRNLEPKPLSIWRLSGIFVCCAGL-------------YLVALIVFILEILTTNHRRL 613
                  ||.:        :...|..||...|:             |.:||::.||||...  |..
  Fly   563 ------SKTK--------LHTFSNSFVIQVGMEYAAPLFISLLVAYFLALLILILEICWA--RYA 611

  Fly   614 RRAFNVI 620
            ::.|:.|
  Fly   612 KKKFSTI 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7cNP_001245572.1 Lig_chan-Glu_bd 225..287 CDD:214911 3/7 (43%)
Lig_chan 343..593 CDD:278489 52/289 (18%)
Ir75cNP_649013.3 Lig_chan 328..553 CDD:306551 45/248 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462769
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.