DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7c and Ir64a

DIOPT Version :9

Sequence 1:NP_001245572.1 Gene:Ir7c / 31692 FlyBaseID:FBgn0029966 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_647962.1 Gene:Ir64a / 38616 FlyBaseID:FBgn0035604 Length:859 Species:Drosophila melanogaster


Alignment Length:283 Identity:58/283 - (20%)
Similarity:86/283 - (30%) Gaps:116/283 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 SLLGGLALY-----------------------NPQRNFARYI---------------LVMWLLQT 414
            |.|||:.||                       ||..|:..::               |..|...|
  Fly   234 SFLGGMNLYMNTELTLAKRMSEAAHYTLFDVWNPGLNYGGHVNLTEIGSFTPTEGIQLHTWFRTT 298

  Fly   415 LILRAA------------------YTGQLYLLLQDVEMRSPIKSLSEVLAKDYEFRILPALRTIF 461
            ..:|..                  .||.|...|... |...|.:::.     :.|.:|.|:|.:|
  Fly   299 STVRRRMDMQHARVRCMVVVTNKNMTGTLMYYLTHT-MSGHIDTMNR-----FNFNLLMAVRDMF 357

  Fly   462 KDSMPTTNFHAVLSLEESLYRLRDEDDPGITVALLQPTVNQFDFRSGP----NKRH--LTVLPDP 520
                   |:..|||...|...:::....|:..||::   |:.|....|    .:||  :.|....
  Fly   358 -------NWTFVLSRTTSWGYVKNGRFDGMIGALIR---NETDIGGAPIFYWLERHKWIDVAGRS 412

  Fly   521 LMTAPLTFYMRPHSYFKRRIDRLIMAMMSSGIVARYRKMYMDRIKRVSKRRNLEPKPLSIWRLSG 585
            ..:.|...:..|.|..|   ||::.                           |:|....:|.|  
  Fly   413 WSSRPCFIFRHPRSTQK---DRIVF---------------------------LQPFTNDVWIL-- 445

  Fly   586 IFVCCAGLYLVALIVFILEILTT 608
             .|.|.     .|.||||..|||
  Fly   446 -IVGCG-----VLTVFILWFLTT 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7cNP_001245572.1 Lig_chan-Glu_bd 225..287 CDD:214911
Lig_chan 343..593 CDD:278489 50/266 (19%)
Ir64aNP_647962.1 Periplasmic_Binding_Protein_Type_2 351..>465 CDD:304360 37/160 (23%)
Lig_chan 563..828 CDD:278489
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462935
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.