DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7c and GRIK3

DIOPT Version :9

Sequence 1:NP_001245572.1 Gene:Ir7c / 31692 FlyBaseID:FBgn0029966 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_000822.2 Gene:GRIK3 / 2899 HGNCID:4581 Length:919 Species:Homo sapiens


Alignment Length:484 Identity:117/484 - (24%)
Similarity:194/484 - (40%) Gaps:97/484 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 APANGFGLTK------PLFPRKLTNMHGCEMVVATFEHRPYVIIEDDPKTPGGRSIHGIEGL--- 247
            :||:|..:|:      |.....|||.   .::|.|....|:|:.....:|..|..  ..||.   
Human   409 SPADGLNITEVAKGRGPNVTDSLTNR---SLIVTTVLEEPFVMFRKSDRTLYGND--RFEGYCID 468

  Fly   248 IFRSLAERMNFT--IKLVE------QKDKNRGEILPDGNFTGILKMMVDGEVNLTFVCFMYSKAR 304
            :.:.||..:.|:  |:|||      |.||        |.:.|::|.::|.:.:|.......:..|
Human   469 LLKELAHILGFSYEIRLVEDGKYGAQDDK--------GQWNGMVKELIDHKADLAVAPLTITHVR 525

  Fly   305 SDLMLPSTSYTSFPIVLVV--PSGGSISPMGRLTRPFRYIIWSCILVSLIFGFVLICLLKITAL- 366
            ...:..|..:.:..:.::.  |:|.:.|....| .|....||..:|::.:   .:.|:|.:.|. 
Human   526 EKAIDFSKPFMTLGVSILYRKPNGTNPSVFSFL-NPLSPDIWMYVLLAYL---GVSCVLFVIARF 586

  Fly   367 ------------PGL----RNLVLGRRNRLPFMGMWASLLGGLALYNPQRNFARYILVMWLLQTL 415
                        ||.    .|..|  .|...| ||.:.:..|..|. |:....|.|..:|...||
Human   587 SPYEWYDAHPCNPGSEVVENNFTL--LNSFWF-GMGSLMQQGSELM-PKALSTRIIGGIWWFFTL 647

  Fly   416 ILRAAYTGQLYLLLQDVEMRSPIKSLSEVLAKD--YEFRILP--ALRTIFKDSMPTT--NFHAVL 474
            |:.::||..|...|....|.|||.|..: |||.  .|:..:.  |..|.||.|..:|  ...|.:
Human   648 IIISSYTANLAAFLTVERMESPIDSADD-LAKQTKIEYGAVKDGATMTFFKKSKISTFEKMWAFM 711

  Fly   475 SLEESLYRLRDEDDPGITVA-------LLQPTVNQFDFRSGPNKRHLTVLPDPL---MTAPLTFY 529
            |.:.|  .|...::.||..|       |::.|..::..:...|...:..|.|..   :..|:...
Human   712 SSKPS--ALVKNNEEGIQRALTADYALLMESTTIEYVTQRNCNLTQIGGLIDSKGYGIGTPMGSP 774

  Fly   530 MRPHSYFKRRIDRLIMAMMSSGIVARYRKMYMDRIK--RVS---KRRNLEPKPLSIWRLSGIF-V 588
            .|         |::.:|::.   :....|:::.:.|  |.|   :..|.|...|.|.::.||| |
Human   775 YR---------DKITIAILQ---LQEEDKLHIMKEKWWRGSGCPEEENKEASALGIQKIGGIFIV 827

  Fly   589 CCAGLYLVALIV---FILEILTTNHRRLR 614
            ..|||.|..|:.   |:.::..|..|..|
Human   828 LAAGLVLSVLVAVGEFVYKLRKTAEREQR 856

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7cNP_001245572.1 Lig_chan-Glu_bd 225..287 CDD:214911 19/72 (26%)
Lig_chan 343..593 CDD:278489 71/288 (25%)
GRIK3NP_000822.2 PBP1_iGluR_Kainate_GluR5_7 34..417 CDD:107388 3/7 (43%)
ANF_receptor 55..398 CDD:279440
PBP2_iGluR_Kainate_GluR7 433..801 CDD:270441 91/403 (23%)
Lig_chan 564..832 CDD:278489 71/289 (25%)
Glutamate binding. /evidence=ECO:0000250 690..692 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156180
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.