DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7c and GRID2

DIOPT Version :9

Sequence 1:NP_001245572.1 Gene:Ir7c / 31692 FlyBaseID:FBgn0029966 Length:625 Species:Drosophila melanogaster
Sequence 2:XP_011530195.2 Gene:GRID2 / 2895 HGNCID:4576 Length:1035 Species:Homo sapiens


Alignment Length:303 Identity:68/303 - (22%)
Similarity:116/303 - (38%) Gaps:57/303 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 GLTKPLFPRKL-TNMHGCEMVVATFEHRPYVIIEDD----PKTPGGRSIHGIEGLIFRSLAERMN 257
            ||...|..:|| .||.|..:.|.|....|:|::.::    ||...|.||.     :..:|:..:.
Human   452 GLNGSLTDKKLENNMRGVVLRVVTVLEEPFVMVSENVLGKPKKYQGFSID-----VLDALSNYLG 511

  Fly   258 FTIKLVEQKDKNRGEILPDGNFTGILKMMVDGEVNLTFVCFMYSKARSDLMLPSTSYTSFPIVLV 322
            |..::....|...|....||.:.|::..:|....::.......:..|.:::..:|.|..:.:.::
Human   512 FNYEIYVAPDHKYGSPQEDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRYMDYSVGVL 576

  Fly   323 VPSGGSISPMGRLTRPFRYIIWSCILVSLIFGFVLICLLKITALPGLRNLVLGRRNRLPFMGMWA 387
            :........|.....||...:|:||..:::...:|:.||.....|.|:            ||...
Human   577 LRRAEKTVDMFACLAPFDLSLWACIAGTVLLVGLLVYLLNWLNPPRLQ------------MGSMT 629

  Fly   388 SLLGGLALYN----------------PQRNFA-RYILVMWLLQTLILRAAYTGQLYLLLQDVEMR 435
            |    ..|||                |....| |.::..|.|..||:.::||..|...|....:.
Human   630 S----TTLYNSMWFVYGSFVQQGGEVPYTTLATRMMMGAWWLFALIVISSYTANLAAFLTITRIE 690

  Fly   436 SPIKSLSEVLAKD-------------YEFRILPALRTIFKDSM 465
            |.|:||.: |:|.             ||...:..|....:|||
Human   691 SSIQSLQD-LSKQTEIPYGTVLDSAVYEHVRMKGLNPFERDSM 732

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7cNP_001245572.1 Lig_chan-Glu_bd 225..287 CDD:214911 14/65 (22%)
Lig_chan 343..593 CDD:278489 37/153 (24%)
GRID2XP_011530195.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156072
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.