DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7c and GRIA1

DIOPT Version :9

Sequence 1:NP_001245572.1 Gene:Ir7c / 31692 FlyBaseID:FBgn0029966 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_001244950.1 Gene:GRIA1 / 2890 HGNCID:4571 Length:916 Species:Homo sapiens


Alignment Length:462 Identity:92/462 - (19%)
Similarity:177/462 - (38%) Gaps:96/462 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 VVATFEHRPYVIIEDDPKTPGGRSIHGIEGL---IFRSLAERMNFTIKLVEQKDKNRGEILPDGN 278
            :|.|....|||:::.:.....|...:  ||.   :...:|:.:.::.:|         ||:.||.
Human   420 IVTTILEDPYVMLKKNANQFEGNDRY--EGYCVELAAEIAKHVGYSYRL---------EIVSDGK 473

  Fly   279 F----------TGILKMMVDGEVNLTFVCFMYSKARSDLMLPSTSYTSFPIVLVVPSGGSISP-M 332
            :          .|::..:|.|..::.......:..|.:::..|..:.|..|.:::.......| :
Human   474 YGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGV 538

  Fly   333 GRLTRPFRYIIWSCILVSLIFGFVLICLLKITALP----------GLRNLVLGRRNRLP-FMGMW 386
            .....|..|.||.||:.:.| |..::..|.....|          |.......:.|... |..:|
Human   539 FSFLDPLAYEIWMCIVFAYI-GVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLW 602

  Fly   387 ASLLGGLAL-----YNPQRNFARYILVMWLLQTLILRAAYTGQLYLLLQDVEMRSPIKSLSEVLA 446
            .||  |..:     .:|:....|.:..:|...|||:.::||..|...|....|.|||:| :|.||
Human   603 FSL--GAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIES-AEDLA 664

  Fly   447 KDYE--------------FR-----ILPALRTIFKDSMPTTNFHAVLSLEESLYRLRDEDDPGIT 492
            |..|              ||     :...:.|..|.:.|:.   .|.:.||.:.|:|  ...|..
Human   665 KQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSV---FVRTTEEGMIRVR--KSKGKY 724

  Fly   493 VALLQPTVNQFDFRSGP-----------NKRHLTVLPDPLMTAPLTFYMRPHSYFKRRIDRLIMA 546
            ..||:.|:|::..:..|           :|.:....|             ..|..:..::..::.
Human   725 AYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATP-------------KGSALRNPVNLAVLK 776

  Fly   547 MMSSGIVARYR-KMYMDRIKRVSKRRNLEPK--PLSIWRLSGIFVCCAGLYLVALIVFILEILTT 608
            :...|::.:.: |.:.|:.:..|...:.:.|  .||:..::|:|....|...:|::|.::|....
Human   777 LNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYK 841

  Fly   609 NHRRLRR 615
            :....:|
Human   842 SRSESKR 848

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7cNP_001245572.1 Lig_chan-Glu_bd 225..287 CDD:214911 13/74 (18%)
Lig_chan 343..593 CDD:278489 63/298 (21%)
GRIA1NP_001244950.1 PBP1_iGluR_AMPA_GluR1 36..399 CDD:107385
ANF_receptor 47..382 CDD:279440
PBP2_iGluR_AMPA_GluR1 416..797 CDD:270447 81/409 (20%)
Lig_chan 548..827 CDD:278489 64/300 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156053
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.