DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7c and Grik5

DIOPT Version :9

Sequence 1:NP_001245572.1 Gene:Ir7c / 31692 FlyBaseID:FBgn0029966 Length:625 Species:Drosophila melanogaster
Sequence 2:XP_006228444.1 Gene:Grik5 / 24407 RGDID:2735 Length:980 Species:Rattus norvegicus


Alignment Length:445 Identity:97/445 - (21%)
Similarity:179/445 - (40%) Gaps:77/445 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 MVVATFEHRPYVIIEDDPKTPGGRSIHG---IEGL---IFRSLAERMNFTIKLVEQKDKNRGEIL 274
            :||.|....|||:     :.|..:::.|   .||.   :.|.|||.:.|..:|...:|...|...
  Rat   417 LVVTTILENPYVM-----RRPNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPE 476

  Fly   275 PDGNFTGILKMMVDGE-VNLTFVCFMYSKARSDLMLPSTSYTSFPIVLVVPSGGSISPMGR---- 334
            |:|::||::..:::.: .:|....|..:..|..::..|..:.:..|.::..     ..|||    
  Rat   477 PNGSWTGMVGELINRQKADLAVAAFTITAEREKVIDFSKPFMTLGISILYR-----VHMGRKPGY 536

  Fly   335 --LTRPFRYIIWSCILVSLIFGFVLICLLKITAL----------PGLR--------NLVLGRRNR 379
              ...||...:|..:|::.:   .:.|:|.:.|.          |.||        ...||....
  Rat   537 FSFLDPFSPAVWLFMLLAYL---AVSCVLFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLW 598

  Fly   380 LP---FMGMWASLLGGLALYNPQRNFARYILVMWLLQTLILRAAYTGQLYLLLQDVEMRSPIKSL 441
            .|   ||...:.::       |:....|.:..:|...|||:.::||..|...|....|..|::|.
  Rat   599 FPVGGFMQQGSEIM-------PRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPVESA 656

  Fly   442 SEVLAK-DYEFRILPA--LRTIFKDSMPTT-----NFHA-------VLSLEESLYRLRDEDDPGI 491
            .::..: :.|:..:.|  ..|.|::|...|     |:..       |.|.||.:.|:.:..    
  Rat   657 DDLADQTNIEYGTIHAGSTMTFFQNSRYQTYQRMWNYMQSKQPSVFVKSTEEGIARVLNSR---- 717

  Fly   492 TVALLQPTVNQFDFRSGPNKRHLTVLPDPLMTAPLTFYMRPHSYFKRRIDRLIMAMMSSGIVARY 556
            ...||:.|:|::..|...|   ||.:...|.|......|...|.|:..|...|:.:..:..:...
  Rat   718 YAFLLESTMNEYHRRLNCN---LTQIGGLLDTKGYGIGMPLGSPFRDEITLAILQLQENNRLEIL 779

  Fly   557 RKMYMDRIKRVSKRRNLEPKPLSIWRLSGIFVCCAGLYLVALIVFILEILTTNHR 611
            ::.:.:. .|..|..:...|.|.:..:.||||......::|:.|.::|.:.:..|
  Rat   780 KRKWWEG-GRCPKEEDHRAKGLGMENIGGIFVVLICGLIIAVFVAVMEFIWSTRR 833

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7cNP_001245572.1 Lig_chan-Glu_bd 225..287 CDD:214911 19/67 (28%)
Lig_chan 343..593 CDD:278489 61/285 (21%)
Grik5XP_006228444.1 PBP1_iGluR_Kainate_KA1_2 23..401 CDD:380616
Periplasmic_Binding_Protein_Type_2 414..785 CDD:389745 85/394 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350153
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.