DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7c and Gria4

DIOPT Version :10

Sequence 1:NP_572411.1 Gene:Ir7c / 31692 FlyBaseID:FBgn0029966 Length:625 Species:Drosophila melanogaster
Sequence 2:XP_006509904.1 Gene:Gria4 / 14802 MGIID:95811 Length:912 Species:Mus musculus


Alignment Length:32 Identity:10/32 - (31%)
Similarity:16/32 - (50%) Gaps:2/32 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 VGSCND--LLANLQLSILDKFGWEPKEREWIR 145
            |...|:  ||:......|.:..||.:|||.::
Mouse   205 VSPANEKTLLSEDMRKELQRQQWEEEEREALK 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7cNP_572411.1 Lig_chan-Glu_bd 225..287 CDD:214911
Lig_chan 343..592 CDD:459656
Gria4XP_006509904.1 PBP1_iGluR_AMPA_GluR4 28..400 CDD:380611 10/32 (31%)
PBP2_iGluR_AMPA_GluR4 414..795 CDD:270445
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.