DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7b and grik1b

DIOPT Version :9

Sequence 1:NP_572410.2 Gene:Ir7b / 31690 FlyBaseID:FBgn0029965 Length:655 Species:Drosophila melanogaster
Sequence 2:XP_690040.5 Gene:grik1b / 561540 ZFINID:ZDB-GENE-070821-1 Length:906 Species:Danio rerio


Alignment Length:484 Identity:86/484 - (17%)
Similarity:163/484 - (33%) Gaps:151/484 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 LTCATWEDMPYLVWRPD-----GSGSFVGIEGALLQFMAENLNF-------TVGLYWMNKEEVLA 264
            |...|..:.||::::..     |:..|.|....||:.::..|.|       |.|.|....::   
Zfish   474 LIVTTILENPYVMYKKSDKPLYGNDRFEGYCLDLLKELSNILGFSYEVKLVTDGKYGAQNDK--- 535

  Fly   265 TFDESGRIFDEIFGHHADFSLGGFHFKPSAGSEIPYSQSTYYFMSHIMLVTNLQSAY-------- 321
              .|...:..|:..|.||.::        |...|.|.:......|...:...:...|        
Zfish   536 --GEWNGMVRELIDHVADLAV--------APLTITYVREKVIDFSKPFMTLGISILYHKPNGTNP 590

  Fly   322 SAYEKLSFPFTPLLWRAIGLVLILACL----LLMLLVR-----WRHHHELPRNPYYELL------ 371
            ..:..|: |.:|.:|    :.::||||    :|.::.|     |.:.|  |.||..:::      
Zfish   591 GVFSFLN-PLSPDIW----MYVLLACLGVSCVLFVIARFTPYEWYNPH--PCNPDSDVVENNFTL 648

  Fly   372 ----------VLTMGGNLEDRWVPQRFPSRLVLLTWLFATLVLRSGYQSGMYQLLRQDTQRNPPQ 426
                      ::..|..|    :|:...:|:|...|.|.||::.|.|.:.:...|..:...:|..
Zfish   649 INSVWFGVGALMQQGSEL----MPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMDSPID 709

  Fly   427 TISEVLAQHFTIQLAEVNEARILASLPELRPEQLVYLEGSELQSF------------PALAQQSG 479
            :..: ||:...|:...|.:.           ..:.:.:.|::.::            .||.:.:.
Zfish   710 SADD-LAKQTKIEYGAVRDG-----------STMTFFKKSKISTYEKMWAFMSSRKNTALVKNNR 762

  Fly   480 SSARVAILTPYEYFGYFRKVHPMSRRLHLVRERIYTQQLAFYVRRHSHLVG-------------- 530
            ...:..:.|.|........:..:|:|      .....|:...:....:.||              
Zfish   763 EGIQRVLTTDYALLMESTSIEYISQR------NCNLTQIGGLIDSKGYGVGTPIGSPYRDKVTIA 821

  Fly   531 VLNKQIQHAHTHGFLEHWTRQYVSAVDEKDESVARIASTSYSTLDGIDGDPSLSESEEDQQVAPV 595
            :|..| :....|...|.|.|.                          :|.|     |||.:.|  
Zfish   822 ILQLQ-EEGKLHMMKEKWWRG--------------------------NGCP-----EEDSKEA-- 852

  Fly   596 RQNVLSMRELAALFWLILWANLGAVVVFV 624
              :.|.:..:..:| ::|.|.| .:.|||
Zfish   853 --SALGVENIGGIF-IVLAAGL-VLSVFV 877

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7bNP_572410.2 None
grik1bXP_690040.5 Periplasmic_Binding_Protein_Type_1 62..455 CDD:299141
ANF_receptor 80..423 CDD:279440
Periplasmic_Binding_Protein_Type_2 471..840 CDD:304360 71/408 (17%)
Lig_chan 602..871 CDD:278489 55/333 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591605
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.