DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7b and Ir94g

DIOPT Version :9

Sequence 1:NP_572410.2 Gene:Ir7b / 31690 FlyBaseID:FBgn0029965 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_651147.2 Gene:Ir94g / 42768 FlyBaseID:FBgn0039079 Length:545 Species:Drosophila melanogaster


Alignment Length:593 Identity:115/593 - (19%)
Similarity:196/593 - (33%) Gaps:185/593 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 VLALVDGLPSLSAIYARIRATQDLSHTLIYMSMPTDAYGEEMQATLRFLWRLSVLNVGVVLR--P 157
            |||.:.|....:.:.:..|:.:.|....|.:.:..|.....:...|:|.....::||..:..  |
  Fly    71 VLACLPGFHWRALLGSLARSLKYLRQARILIELMQDRDEFLVSEVLQFCLSQDMINVNAIFDDFP 135

  Fly   158 PGDHILMVSYFPFSALHGCQVISANVVNRYQVGTKRWASQDYFPSKLGNFYGCLL-TCATWEDMP 221
            ..:::.....:|          |..|||  |..|......|.:|:|:.|..|.:: |...:.:..
  Fly   136 ETENLSSFEAYP----------SFEVVN--QTFTPDTQVSDLYPNKMLNLRGGVIRTMPDYSEPN 188

  Fly   222 YLVWR-PDGSGSFVGIEGALLQFMAENLNFTVGLYWMNKEEVLATFDESGRIFDEIFGHHADFSL 285
            .:::: .:|:...:|....||:..|...|  ..|..:||..     |:....|.|:.    |.:.
  Fly   189 TILYQDKEGNKEILGYLWDLLEAYAHKHN--AQLQVVNKYA-----DDRPLNFIELL----DAAQ 242

  Fly   286 GGFHFKPSAGSEI-PYSQSTYYFMSHIMLVTNLQSAYSAYEKLSFPFTPLLW-------RAIGLV 342
            .|.   ...|:.| |.|                ..:.|...::|:|.....|       |.:.:.
  Fly   243 SGI---IDVGASIQPMS----------------MGSLSRMHEMSYPVNQASWCTMLPVERQLHVS 288

  Fly   343 LILACL-----LLMLLVRWRHHHELPRNPYYELLVLTMGGNLEDRWVPQRFPSRLVLLTWLFATL 402
            .:|..:     |.:||:.|         .:||:        |..||   |..|||..:.||....
  Fly   289 ELLTRVIPYPTLALLLLLW---------IFYEV--------LRGRW---RRHSRLQSIGWLVLAT 333

  Fly   403 VLRSGYQSGMYQLLRQDTQRNPPQTISEVLAQHFTIQLAEVNEARILASLPELRPEQLVYLEGSE 467
            ::.|.|...:..|.     .:||             .|..||.   ||:|.| .|.:::.:. ||
  Fly   334 LVSSNYVGKLLNLF-----TDPP-------------SLPPVNS---LAALME-SPVRIISIR-SE 375

  Fly   468 LQSFPALAQQSGSSA-------------RVAILTPYEYFGYF--------------RKVHPMSRR 505
            ..:.....:...|:|             |.|..|.|   ||.              |...|:.| 
  Fly   376 YSAIEFTQRTKYSAAFHLALHASILIGLRNAFNTSY---GYTITSEKWKIYEEQQKRSSKPVFR- 436

  Fly   506 LHLVRERIYTQQLAFYV--------------RRHSHLVGVLNKQIQHAHTHGFLEHWTRQYVSAV 556
                    |::.|.||.              |...|...:|.:|   |..|.|   |..:     
  Fly   437 --------YSKDLCFYEMIPFGLVIPENSPHRAPLHSYTLLLRQ---AGLHDF---WVNR----- 482

  Fly   557 DEKDESVARIASTSYSTLDGIDGDPSLSESEEDQQVAPVRQNVLSMRELAALFWLILWANLGAVV 621
                       ..||....|.....::.|..|        ...|::.:|..:|.:.:...|.:::
  Fly   483 -----------GFSYMVKAGKINFTAVGERYE--------AKTLTITDLRNVFIIYVSVLLISLI 528

  Fly   622 VFVLELLL 629
            :|..||.:
  Fly   529 LFTCELFV 536



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.