DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7b and gria4a

DIOPT Version :9

Sequence 1:NP_572410.2 Gene:Ir7b / 31690 FlyBaseID:FBgn0029965 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_999971.1 Gene:gria4a / 407735 ZFINID:ZDB-GENE-020125-7 Length:898 Species:Danio rerio


Alignment Length:386 Identity:76/386 - (19%)
Similarity:136/386 - (35%) Gaps:102/386 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 FMS---HIMLVTNLQSAYSAYEKLSFPFTPLLWRAIGLVLILACLLLMLLVR---WRHHHELPR- 364
            |||   .||:....:|....:..|. |....:|..|....|...::|.|:.|   :..|.|.|. 
Zfish   511 FMSLGISIMIKKPQKSKPGVFSFLD-PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEE 574

  Fly   365 -----------NPY--YELLVLTMGGNLED--RWVPQRFPSRLVLLTWLFATLVLRSGYQSGMYQ 414
                       |.:  :..|..::|..::.  .:.|:....|:|...|.|.||::.|.|.:.:..
Zfish   575 GSDGPPSDQPPNEFGIFNSLWFSLGAFMQQGCDFTPRSLSGRIVGGVWWFFTLIIISSYTANLAA 639

  Fly   415 LLRQDTQRNPPQTISEVLAQHFTIQLAEVNEARILASLPELRPEQLVYLEGSELQSFPALAQQSG 479
            .|..:...:|.:: :|.||:...|....::                   .||..:.|        
Zfish   640 FLTVERMVSPIES-AEDLAKQTEIAYGTLD-------------------SGSTKEFF-------- 676

  Fly   480 SSARVAILTPYE-YFGYFRKVHPMSRRLHLVRERIYTQQLA---FYVRRHSHLVGVLNKQIQHAH 540
            ..:::|:   || .:.|.:...|          .::|:..|   ..||:.......|.:...:.:
Zfish   677 RRSKIAV---YEKMWSYMKSAEP----------TVFTKTTAEGVARVRKSKGKYAFLLESTMNEY 728

  Fly   541 THGFLEHWTRQYVSAVDEKDESVARIASTSYST--------------LDGI---------DGDPS 582
            |.......|.:....:|.|...||....:...|              ||.:         :..|.
Zfish   729 TEQRKPCDTMKVGGNLDSKGYGVATPKGSQLGTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPK 793

  Fly   583 LSESEEDQQVAPVRQNVLSMRELAALFWLILWANLG-AVVVFVLELLLPRIKLRKILRKMK 642
            .|.|::....|      ||:..:|.:|: ||...|| |::|.::|..   .|.|...:|:|
Zfish   794 DSGSKDKSSQA------LSLSNVAGVFY-ILVGGLGLAMLVALVEFC---YKSRAEAKKLK 844

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7bNP_572410.2 None
gria4aNP_999971.1 PBP1_iGluR_AMPA_GluR4 23..393 CDD:107383
ANF_receptor 34..375 CDD:279440
PBP2_iGluR_AMPA_GluR4 408..790 CDD:270445 57/320 (18%)
Lig_chan 540..821 CDD:278489 59/328 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591791
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.