DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7b and Ir75a

DIOPT Version :9

Sequence 1:NP_572410.2 Gene:Ir7b / 31690 FlyBaseID:FBgn0029965 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_649012.2 Gene:Ir75a / 39982 FlyBaseID:FBgn0036757 Length:629 Species:Drosophila melanogaster


Alignment Length:366 Identity:61/366 - (16%)
Similarity:116/366 - (31%) Gaps:130/366 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 PFTPLLWRAIGLVLILACLLLMLLV---------RWRHHHELPRNPYYELLVLTMGGNL--EDRW 383
            ||:||:|...|.||.|..:||.:..         |||..: ||  ......:::.|...  ....
  Fly   332 PFSPLVWYLFGGVLSLIGVLLWITFYMECKRMQKRWRLDY-LP--SLLSTFLISFGAACIQSSSL 393

  Fly   384 VPQRFPSRLVLLTWLFATLVLRSGYQSGMYQLLRQDTQRNPPQTISEVLAQHFTIQL-------A 441
            :|:....||:.......:.::.:.|.|.:...|.....::..:|:.::.....|:.|       :
  Fly   394 IPRSAGGRLIYFALFLISFIMYNYYTSVVVSSLLSSPVKSKIKTMRQLAESSLTVGLEPLPFTKS 458

  Fly   442 EVNEARILASLPEL-------------RPEQLVYLEGSELQ-----SFPALAQQSGSSARV---- 484
            .:|.:|    |||:             .||..:..|...|:     .:..:.:.|...|.|    
  Fly   459 YLNYSR----LPEIHLFIKRKIESQTQNPELWLPAEQGVLRVRDNPGYVYVFETSSGYAYVERYF 519

  Fly   485 ----------AILTPYEYFGYFRKVHPMS--------RRLHLVRERIYTQQLAFYVRRHSHLVGV 531
                      .:..|.:.|  :..:|..|        |.|.::...:|.:|.:::|....|.|  
  Fly   520 TAQEICDLNEVLFRPEQLF--YTHLHRNSTYKELFRLRFLRILETGVYRKQRSYWVHMKLHCV-- 580

  Fly   532 LNKQIQHAHTHGFLEHWTRQYVSAVDEKDESVARIASTSYSTLDGIDGDPSLSESEEDQQVAPVR 596
                             .:.:|..|                                        
  Fly   581 -----------------AQNFVITV---------------------------------------- 588

  Fly   597 QNVLSMRELAALFWLILWANLGAVVVFVLELLLPRIKLRKI 637
                .|..:|.|..:::.|::..||:.::||...|...|.:
  Fly   589 ----GMEYVAPLLLMLICADILVVVILLVELAWKRFFTRHL 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7bNP_572410.2 None
Ir75aNP_649012.2 Lig_chan 337..603 CDD:306551 50/337 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462795
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.