DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7b and Ir67b

DIOPT Version :9

Sequence 1:NP_572410.2 Gene:Ir7b / 31690 FlyBaseID:FBgn0029965 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_648393.1 Gene:Ir67b / 39194 FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster


Alignment Length:501 Identity:99/501 - (19%)
Similarity:163/501 - (32%) Gaps:208/501 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 GNFYGCLLTCATWEDMPYLVWRPDGSGSFVGIEGALLQFMAENLNFTVGLYWM-------NKEEV 262
            |||..|.||....||                          |:|:  .|||::       :..||
  Fly    72 GNFTSCTLTILYLED--------------------------EHLD--RGLYYLANWLWEYHHLEV 108

  Fly   263 L-----ATFDESGRIFDEIFGHHADFSLGGFHFKPSAGSEIPYSQSTYYFMSH----IMLVTNLQ 318
            |     .::|:..:||...|..       ||   .:....:|.|...|.||.:    |:.:.:::
  Fly   109 LIFFNGGSYDKLIQIFSRCFNE-------GF---VNVLVMLPGSDELYTFMPYQDLKILNLKSIK 163

  Fly   319 SAYSAYEKL----SFPFTPLLWRAIGLV----------------LILACLLLMLLVRWRHHHELP 363
            ..||...|.    .:..|.      |||                |||...:|.::|.:.:|.   
  Fly   164 EFYSLSRKKMDLNGYNITS------GLVIAGAPRWFSFRDRQNRLILTGYMLRMIVDFTNHF--- 219

  Fly   364 RNPYYELL-VLTMGGNLE---DRWVPQRFPSRLVLLTWLFATLVLRSGYQSGMYQL----LRQDT 420
             |....|: |||:...||   :|.: ..||         |....|:|...|.:..|    |...|
  Fly   220 -NGSVRLMNVLTVNDGLELLANRTI-DFFP---------FLIRPLKSFSMSNILYLENCGLIVPT 273

  Fly   421 QRNPPQTIS-------------EVLAQHFTIQLAEVNEARILASLPELRPEQLV-YLEGSELQSF 471
            .|..|..:.             .::..:.::.|..:::.:|..|...|:..:|| ||.||     
  Fly   274 SRPLPNWVYLLRPYAFDTWIAWLIMLIYCSLALRILSKGQISISAAFLKVLRLVMYLSGS----- 333

  Fly   472 PALAQQSGSSARVAILTPYEYFGYFRKVHPMSRRLHLVRERIYTQQLAFYVRRHSHLVGVLNKQI 536
                :..|:                   .|.:|||.|           |.:              
  Fly   334 ----RDMGT-------------------RPTTRRLFL-----------FVI-------------- 350

  Fly   537 QHAHTHGFLEHWTRQYVSAVDEKDESVARIASTSYSTLDGIDGDPSLSESEEDQQVAPVRQNVLS 601
              ..|.||:  .|..||:.:  ...|.|.:.....:|.:.:|...|:                  
  Fly   351 --LTTSGFI--LTNLYVAQL--SSNSAAGLYEKQINTWEDLDKSDSI------------------ 391

  Fly   602 MRELAALFWLILWANLGAVVVFVLELLLP-RIK-LRKILRKMKSDI 645
                    |.::     .|.:..:|.|:| |.| |:||:..:::|:
  Fly   392 --------WPLI-----DVDIKTMEKLIPDRTKLLKKIVPTLEADV 424



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.