DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7b and gria3b

DIOPT Version :9

Sequence 1:NP_572410.2 Gene:Ir7b / 31690 FlyBaseID:FBgn0029965 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_938174.1 Gene:gria3b / 368416 ZFINID:ZDB-GENE-030616-53 Length:883 Species:Danio rerio


Alignment Length:494 Identity:88/494 - (17%)
Similarity:172/494 - (34%) Gaps:115/494 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 LTCATWEDMPYLVWRP-----DGSGSFVGIEGALLQFMAENLNFTV-------GLYWMNKEEVLA 264
            :...|..:.||::::.     :|:..:.|....|...:|:::....       |.|.....|   
Zfish   415 IVVTTIMEAPYVMYKKNHMHLEGNEKYEGYCVDLASEIAKHVGIKYRLSIVMDGKYGARDPE--- 476

  Fly   265 TFDESGRIFDEIFGHHADFSLGGFHFKPSAGSEIPYSQSTYYFMS---HIMLVTNLQSAYSAYEK 326
            |...:|.:.:.::| .||.::............|.:|:.   |||   .||:....:|....:..
Zfish   477 TKSWNGMVGELVYG-RADIAVAPLTITLVREEVIDFSKP---FMSLGISIMIKKPQKSKPGVFSF 537

  Fly   327 LSFPFTPLLWRAIGLVLILACLLLMLLVRWRHHH------------ELPRNP-----YYELLVLT 374
            |. |....:|..|....|...::|.|:.|:..:.            :.|.:|     .:..|..:
Zfish   538 LD-PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWQLDETDEVKDPQTPPDPPNDFGIFNSLWFS 601

  Fly   375 MGGNLEDRW--VPQRFPSRLVLLTWLFATLVLRSGYQSGMYQLLRQDTQRNPPQTISEVLAQ--- 434
            :|..::...  .|:....|:|...|.|.||::.|.|.:.:...|..:...:|.::..::..|   
Zfish   602 LGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEI 666

  Fly   435 -HFTIQLAEVNE--ARILASLPELRPEQLVYLEGSELQSF-----PALAQQSGSSARVAIL---T 488
             :.|:......|  .|...::.|   :...|::.:|...|     ..:|:...|..:.|.|   |
Zfish   667 AYGTLDSGSTKEFFRRSKIAVYE---KMWSYMKSAEPSVFAKTTPDGVARVRKSKGKFAFLLEST 728

  Fly   489 PYEYFGYFRKVHPMSRRLHLVRERIYTQQLAFYVRRHSHLVGVLNKQIQHAHTHGFLEHWTRQY- 552
            ..||....:....|.     |...:.::.......:.|.|...:|..:...:..|.|:....:: 
Zfish   729 MNEYIEQRKPCDTMK-----VGGNLDSKGYGVATPKGSALRNAVNLAVLKLNEQGLLDKLKNKWW 788

  Fly   553 -------VSAVDEKDESVARIASTSYSTLDGIDGDPSLSESEEDQQVAPVRQNVLSMRELAALFW 610
                   ....|.||::.|                                   ||:..:|.:|:
Zfish   789 YDKGECGSGGGDSKDKTSA-----------------------------------LSLSNVAGVFY 818

  Fly   611 LILWANLG-AVVVFVLELL------LPRIKLRKILRKMK 642
             ||...|| |::|.::|..      ..|:||.|..:..|
Zfish   819 -ILVGGLGLAMMVALIEFCYKSRAEAKRLKLEKNAQNYK 856

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7bNP_572410.2 None
gria3bNP_938174.1 Periplasmic_Binding_Protein_Type_1 25..396 CDD:299141
ANF_receptor 36..379 CDD:279440
PBP2_iGluR_AMPA 412..794 CDD:270433 68/394 (17%)
Lig_chan 544..824 CDD:278489 53/323 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591855
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.