DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7b and GluRIIB

DIOPT Version :9

Sequence 1:NP_572410.2 Gene:Ir7b / 31690 FlyBaseID:FBgn0029965 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_523485.3 Gene:GluRIIB / 33789 FlyBaseID:FBgn0020429 Length:913 Species:Drosophila melanogaster


Alignment Length:516 Identity:91/516 - (17%)
Similarity:186/516 - (36%) Gaps:109/516 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 KRWASQDYFPSKLGNFYGCLLTCATWEDMPYLVWRP-------DGSGSFVGIEGALLQFMAENLN 249
            ||..:::.|..|...:     |.||....||..||.       :|:..|.|....|:..:|:...
  Fly   409 KRLQNKEDFSQKPIRY-----TVATRVGKPYFSWREEPEGVHYEGNERFEGYAVDLIYMLAQECK 468

  Fly   250 FTVGLYWMNKEEVL--------ATFDESGRIFDEIFGHHADFSLGGFHFKPSAGSEIPYSQSTYY 306
            |.     .|.|.|.        |..||...|..::..::|...:.......:..|.:.:   |..
  Fly   469 FD-----FNFEPVRDNKYGSYDANTDEWDGIIRQLIDNNAQIGICDLTITQARRSVVDF---TVP 525

  Fly   307 FMSHIMLVTNLQSAYSAYEKLSF--PFTPLLWRAIGLVLILACLLLMLLVR-----WRH-----H 359
            ||...:.:.:.:......:..:|  |:...:|..:.:.:::....|:...|     |..     :
  Fly   526 FMQLGISILSYKEPPPKADIYAFLNPYNAEVWLFVMIAMMITAFALIFTGRIDQYEWDQPVENVN 590

  Fly   360 HELPRNPYYEL---LVLTMGGNLED--RWVPQRFPSRLV-LLTWLFATLV-----------LRSG 407
            .|:.|...:.|   |.|.:|..|..  ..:|:..|.||: ...|:||.|:           :.|.
  Fly   591 REMERQNIWHLSNALWLVLGSMLNQGCDLLPRGLPMRLLTAFWWIFALLISQTYIAKLAAFITSS 655

  Fly   408 YQSGMYQLLRQDTQRNPPQTISEVLAQHFTIQLAEVNEA-------RILASLPELRPEQLVYLEG 465
            ..:|....|.....:|..| ...:.....::..:|.|:.       ::|:..|:      .:.:.
  Fly   656 KIAGDIGSLHDLVDQNKVQ-FGTIRGGATSVYFSESNDTDNRMAWNKMLSFKPD------AFTKN 713

  Fly   466 SELQSFPALAQQSGSSARVAILTPYEYFGYFRKVHPMSRRLHLVRERIYTQQLAFYVRRHSHLVG 530
            :| :....:....|:.|.:...|..:|:        :.|...|      ||....:..:|..:..
  Fly   714 NE-EGVDRVKLSKGTYAFLMETTNLQYY--------VQRNCEL------TQIGESFGEKHYGIAV 763

  Fly   531 VLNKQIQHAHTHGFLEHWTRQYVSAVDEKDESVARIASTSYSTLDGIDGDPSLSESEEDQQVAPV 595
            .||...:...:.|.|.         :.|:.| :.::.:..:::          :||..|..|..:
  Fly   764 PLNADFRSNLSVGILR---------LSERGE-LFKLRNKWFNS----------NESTCDSNVPTI 808

  Fly   596 RQNVLSMRELAALFWLILWANLGAVVVFVLELL--LPRIKLRKILRKMKSDIKKQISKLVR 654
            ......|..:..||.:::...:..:|:.|.|.|  :.||.:::.:..|.: :|.:...::|
  Fly   809 DDGQFDMDSVGGLFVVLIVGVVVGLVIGVAEFLWHVQRISVKEKIPPMLA-LKAEFYFVIR 868

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7bNP_572410.2 None
GluRIIBNP_523485.3 PBP1_iGluR_Kainate 26..393 CDD:107377
ANF_receptor 41..378 CDD:279440
PBP2_iGluR_Kainate 422..795 CDD:270432 71/417 (17%)
Lig_chan 555..822 CDD:278489 49/308 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462678
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.