DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7b and GRID1

DIOPT Version :9

Sequence 1:NP_572410.2 Gene:Ir7b / 31690 FlyBaseID:FBgn0029965 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_060021.1 Gene:GRID1 / 2894 HGNCID:4575 Length:1009 Species:Homo sapiens


Alignment Length:256 Identity:51/256 - (19%)
Similarity:93/256 - (36%) Gaps:47/256 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 GCLLTCATWEDMPYLVWRPDGSGS---FVGIEGALLQFMAENLNFTVGLYWMNKEEVLATFDESG 270
            |..|...|..:.|:::...:..|.   :.|....:|..:|:.|.|        |.|:....|  |
Human   436 GLTLKVVTVLEEPFVMVAENILGQPKRYKGFSIDVLDALAKALGF--------KYEIYQAPD--G 490

  Fly   271 R------------IFDEIFGHHADFSLGGFHFKPSAGSEIPYSQSTYYFMSHIMLVTNLQSAYSA 323
            |            :..|:....||.::......|...|.:.:|: .|...|..:|:...:...|.
Human   491 RYGHQLHNTSWNGMIGELISKRADLAISAITITPERESVVDFSK-RYMDYSVGILIKKPEEKISI 554

  Fly   324 YEKLSFPFTPLLWRAIGLVLILACLLLMLLVRWR----HHHELPR----NPYYELLVLTMGGNLE 380
            : .|..||...:|..|...:.:..:|:.:|.|.:    .....||    ...:..:.:..|.   
Human   555 F-SLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRAQSAAQPRPSASATLHSAIWIVYGA--- 615

  Fly   381 DRWVPQRFPS-------RLVLLTWLFATLVLRSGYQSGMYQLLRQDTQRNPPQTISEVLAQ 434
              :|.|...|       |:|:.:|...||::.|.|.:.:...|......||.:|..::..|
Human   616 --FVQQGGESSVNSMAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNPIRTFQDLSKQ 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7bNP_572410.2 None
GRID1NP_060021.1 Interaction with CBLN1. /evidence=ECO:0000250|UniProtKB:Q61627 21..436 51/256 (20%)
PBP1_iGluR_delta_1 25..423 CDD:107387
ANF_receptor 41..400 CDD:279440
PBP2_iGluR_delta_1 436..806 CDD:270448 51/256 (20%)
Lig_chan 564..841 CDD:278489 23/116 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 930..954
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155872
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.