DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7b and Ir41a

DIOPT Version :9

Sequence 1:NP_572410.2 Gene:Ir7b / 31690 FlyBaseID:FBgn0029965 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_995744.4 Gene:Ir41a / 2768714 FlyBaseID:FBgn0040849 Length:648 Species:Drosophila melanogaster


Alignment Length:517 Identity:112/517 - (21%)
Similarity:190/517 - (36%) Gaps:125/517 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 VVNRYQVGTKRWA-SQDYFPSKLGNFYGCLLTCATWEDMPYLVWRPD-----------GSGSF-- 233
            :|:||....:|:. .:..|..||.|..|..:..|.::..||.|.:.:           |...|  
  Fly   183 LVDRYLASEQRFQFGKSLFADKLNNLQGREVIIAGFDYPPYTVIKHNMSTNAQDMGVSGESDFKN 247

  Fly   234 VGIEGA----LLQFMAENLNFTVGLYWMNKEEVLATFDES-----GRIFDEIFG---------HH 280
            |.|:|.    :|.| .|..|.|:.:            |.|     |:::..:.|         ..
  Fly   248 VYIDGTETRIVLNF-CEQFNCTIQI------------DSSAANDWGKVYPNMSGDGALGMLINRK 299

  Fly   281 ADFSLGGFHFKPSAGSEIPYSQSTYYFMSHIMLVTNLQSAYSAYEKLSF------PFTPLLWRAI 339
            ||..:|..:..        |...||..:|..::.:.:.....|..:|:.      ||...||.||
  Fly   300 ADICIGAMYSW--------YEDYTYLDLSMYLVRSGITCLVPAPLRLTSWYLPLEPFKETLWAAI 356

  Fly   340 GLVLILACLLLMLLVRWRHHHELPRNPYYE---------------LLVLTMGGNLEDRWVPQRFP 389
              :|.|......|::.::....|...|.|.               .|.::..||.:    .....
  Fly   357 --LLCLCAEATGLVLAYKSEQALYVLPGYREGWWTCTSFGVCTTFKLFISQSGNSK----AYSLT 415

  Fly   390 SRLVLLTWLFATLVLRSGYQSGMYQLLRQDTQRNPPQTISEVLAQHFTIQLAEVNEA---RILAS 451
            .|::|.......|::.|.|..|:..:|...:......|::.:  :...:|.|..:||   .|.||
  Fly   416 VRVLLFACFLNDLIITSIYGGGLASILTIPSMDEAADTVTRL--RFHRLQWAANSEAWVSAIRAS 478

  Fly   452 LPELRPEQL----VYLEGSELQSFPALAQQSGSSARVAILT---PYEYFGYFRKVHPMS-RRLHL 508
            ...|..:.|    :|.:...|:    |||.  ...|:....   |:.:|.....:.|.: .:|.:
  Fly   479 DEALVKDILYNFHIYSDDELLR----LAQD--QHMRIGFTVERLPFGHFAIGNYLGPQAIDQLVI 537

  Fly   509 VRERIYTQQLAFYVRRHSHLVGVLNKQIQHAHTHGFLEHWTRQYVSAVDEKDESVARIASTSYST 573
            :::.||.|....:|.|...|:..||..|...|:.||.::|..:.|:     |....:|......|
  Fly   538 MKDDIYFQYTVAFVPRLWPLLDKLNTLIYSWHSSGFDKYWEYRVVA-----DNLNLKIQQQVQET 597

  Fly   574 LDGIDGDPSLSESEEDQQVAPVRQNVLSMRELAALFWLILWANLG---AVVVFVLELLLPRI 632
            :.|            .:.:.||   .|.|...|.  ::|:|. ||   |.:.|:|||.|..|
  Fly   598 MTG------------TKDIGPV---PLGMSNFAG--FIIVWI-LGSAIATLTFLLELSLTYI 641



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463052
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.