DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7b and Grin3b

DIOPT Version :9

Sequence 1:NP_572410.2 Gene:Ir7b / 31690 FlyBaseID:FBgn0029965 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_579842.2 Gene:Grin3b / 170796 RGDID:621705 Length:1002 Species:Rattus norvegicus


Alignment Length:460 Identity:86/460 - (18%)
Similarity:149/460 - (32%) Gaps:144/460 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 LLQFMAENLNFTVGLYWMNKEEVLATFDESGR---IFDEIFGHHADFSLGGFHFKPSAGSEIPYS 301
            ||:.:||:|.|...||.:...:..|..|  ||   :..::....|..::..|....:....:.::
  Rat   483 LLERLAEDLAFDFELYIVGDGKYGALRD--GRWTGLVGDLLAGRAHMAVTSFSINSARSQVVDFT 545

  Fly   302 QSTYYFMSHIMLVTNLQSAYSAYEKLSFPFTPLLWRAIGLVLILACLLLMLLVRWRHHHEL-PR- 364
            ..  :|.:.:.::...:...|......:|....:|..:...|.|..|.| .|..||..:.| || 
  Rat   546 SP--FFSTSLGIMVRTRDTASPIGAFMWPLHWSMWVGVFAALHLTALFL-TLYEWRSPYGLTPRG 607

  Fly   365 -------------NPYYELLVLTMGGNLEDRWVPQRFPSRLVLLTWLFATLVLRSGYQSGMYQLL 416
                         |..|.:|.    |.......|:....|.::..|....|::.|.|.:.:..::
  Rat   608 RNRGTVFSYSSALNLCYAILF----GRTVSSKTPKCPTGRFLMNLWAIFCLLVLSSYTANLAAVM 668

  Fly   417 RQDTQRNPPQTISEVLAQH------------FTIQLAEVNEARILASLPELR-----------PE 458
            ..|      :|..|:...|            |........||.|.||.||:.           |.
  Rat   669 VGD------KTFEELSGIHDPKLHHPSQGFRFGTVWESSAEAYIKASFPEMHAHMRRHSAPTTPH 727

  Fly   459 QLVYL--EGSELQSF----PALAQQSGSSARVAILT---PYEYFGYFRKVHPMSRRLHLVRERIY 514
            .:..|  :..:|.:|    ..|..:....|...:||   |:...||         .:.|.:....
  Rat   728 GVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGY---------GIGLPQNSPL 783

  Fly   515 TQQLAFYVRRHSHLVGVLNKQIQHAHTHGFL----EHWTR-----QYVSAVDEKDESVARIASTS 570
            |..|:.::.|:.              :.||:    :.|.:     :.|.||.|            
  Rat   784 TSNLSEFISRYK--------------SSGFIDLLHDKWYKMVPCGKRVFAVTE------------ 822

  Fly   571 YSTLDGIDGDPSLSESEEDQQVAPVRQNVLSMRELAALFWLI-------LWANLGAVVVFVLELL 628
              ||.                        :.:...:.||.|:       |..:||..|.:  .|:
  Rat   823 --TLQ------------------------MGVYHFSGLFVLLCLGLGSALLTSLGEHVFY--RLV 859

  Fly   629 LPRIK 633
            ||||:
  Rat   860 LPRIR 864

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7bNP_572410.2 None
Grin3bNP_579842.2 PBP1_iGluR_NMDA_NR3 21..405 CDD:107372
PBP2_iGluR_NMDA_Nr3 414..808 CDD:270438 67/362 (19%)
Lig_chan 576..842 CDD:278489 60/337 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 882..910
Involved in the trafficking and surface expression of NMDARs. /evidence=ECO:0000250 951..984
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350191
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.