DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7b and Grin2a

DIOPT Version :9

Sequence 1:NP_572410.2 Gene:Ir7b / 31690 FlyBaseID:FBgn0029965 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_032196.2 Gene:Grin2a / 14811 MGIID:95820 Length:1464 Species:Mus musculus


Alignment Length:325 Identity:63/325 - (19%)
Similarity:104/325 - (32%) Gaps:132/325 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CSLV--------AST-----MESSSDW----DLAEALAQVVANSEMGRFKTLYIYTHTNSQSTG- 57
            |.||        |:|     ::..|.|    ||  ||.|.|.:.||...:||::        || 
Mouse   745 CKLVTIGSGYIFATTGYGIALQKGSPWKRQIDL--ALLQFVGDGEMEELETLWL--------TGI 799

  Fly    58 GHLEELLDQVLMIVPNNLQARRLLLQQSMEYKPYVHAVLALVDGLPSLSAIYARIRATQDLS-HT 121
            .|.|:          |.:.:.:|                    .:.:::.::..:.|...|| .|
Mouse   800 CHNEK----------NEVMSSQL--------------------DIDNMAGVFYMLAAAMALSLIT 834

  Fly   122 LIYMSMPTDAYGEEMQATLRFLWRLSVLNVGVVLRPPGDHILMVSYFPFSALHGCQV-------- 178
            .|:..:              |.|:|.....||....|| .:..:|...:|.:||..:        
Mouse   835 FIWEHL--------------FYWKLRFCFTGVCSDRPG-LLFSISRGIYSCIHGVHIEEKKKSPD 884

  Fly   179 ---------------ISANVVNRYQVGTKRWASQDYFPSKLGNFY--GCLLTCATWEDMPYLVWR 226
                           .:.|:.|...:.:.|..|    |.:..:|.  |.|:.... .|...|:: 
Mouse   885 FNLTGSQSNMLKLLRSAKNISNMSNMNSSRMDS----PKRAADFIQRGSLIVDMV-SDKGNLIY- 943

  Fly   227 PDGSGSFVGIEGALLQFMAENLNFTVGLYWMNKEEVLATFDESGRIFDEIFGHHADFSLGGFHFK 291
             ..:.||.|.:    ....||:|            .|.||         :...|.| ||..:.|:
Mouse   944 -SDNRSFQGKD----SIFGENMN------------ELQTF---------VANRHKD-SLSNYVFQ 981

  Fly   292  291
            Mouse   982  981

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7bNP_572410.2 None
Grin2aNP_032196.2 PBP1_iGluR_NMDA_NR2 32..392 CDD:107373
PBP2_iGluR_NMDA_Nr2 403..802 CDD:270436 19/66 (29%)
HisJ <458..>541 CDD:223904
Lig_chan 556..828 CDD:278489 24/122 (20%)
NMDAR2_C 839..1464 CDD:287527 35/191 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846473
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.