DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7b and grin2b

DIOPT Version :9

Sequence 1:NP_572410.2 Gene:Ir7b / 31690 FlyBaseID:FBgn0029965 Length:655 Species:Drosophila melanogaster
Sequence 2:XP_017948700.2 Gene:grin2b / 100490580 XenbaseID:XB-GENE-949327 Length:1449 Species:Xenopus tropicalis


Alignment Length:380 Identity:71/380 - (18%)
Similarity:120/380 - (31%) Gaps:145/380 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CSLV--------AST-----MESSSDW----DLAEALAQVVANSEMGRFKTLYIYTHTNSQSTG- 57
            |.||        |:|     ::..|.|    ||  |:.|:..:.||...:.|::        || 
 Frog   743 CKLVTIGSGKVFATTGYGIAIQKDSGWKRQVDL--AILQLFGDGEMEELEALWL--------TGI 797

  Fly    58 GHLEELLDQVLMIVPNNLQARRLLLQQSMEYKPYVHAVLALVDGLPSLSAIYARIRATQDLSHTL 122
            .|.|:          |.:.:.:|                    .:.:::.::..:.|...||  |
 Frog   798 CHNEK----------NEVMSSQL--------------------DIDNMAGVFYMLAAAMALS--L 830

  Fly   123 IYMSMPTDAYGEEMQATLRFLWRLSVLNVGVVLRPPGDHILMVSYFPFSALHGCQV--------- 178
            |...|      |.:     |.|:|....:||....|| .:..:|...:|.:||..:         
 Frog   831 ITFIM------EHL-----FFWQLRHCFMGVCSGKPG-VVFSISRGIYSCIHGVPIEDRQSAMNS 883

  Fly   179 ISANVVNRYQVGTKRWASQDYFPSKLGNFYGCLLTCATWEDMPYLVWRPDGSGSFVGIEGALLQF 243
            .||.:.|.:                 .|....|.|.....::..:...|..:..|:..|.::...
 Frog   884 PSATMNNTH-----------------SNILRLLRTAKNMANLSGVNGSPQSALDFIRRESSVYDI 931

  Fly   244 MAENLNFT----------VGLYWMNKEEVLATFD----ESGRIFDEIFGHHADFSLGG------- 287
            .....:||          ..|:.....||..||.    :...::.:.|.||...|:|.       
 Frog   932 SEHRRSFTHSDCKSFQPEENLFSDYISEVERTFGNLQLKDSNVYQDHFHHHRPHSIGSNSSIDGL 996

  Fly   288 -------FHFKPSAGSEIPYSQSTYYFMSHIMLVTNLQSAYSA------YEKLSF 329
                   |..:|.:.|:.|             |...|.|.:|:      |.|.||
 Frog   997 YDCDNAPFTTQPRSLSKKP-------------LDIGLPSKHSSTQIGDLYGKFSF 1038

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7bNP_572410.2 None
grin2bXP_017948700.2 PBP1_iGluR_NMDA_NR2 28..383 CDD:380601
PBP2_iGluR_NMDA_Nr2 400..800 CDD:270436 16/66 (24%)
NMDAR2_C 837..1449 CDD:402274 44/238 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.