DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7b and LOC100334689

DIOPT Version :9

Sequence 1:NP_572410.2 Gene:Ir7b / 31690 FlyBaseID:FBgn0029965 Length:655 Species:Drosophila melanogaster
Sequence 2:XP_017206939.1 Gene:LOC100334689 / 100334689 -ID:- Length:991 Species:Danio rerio


Alignment Length:288 Identity:57/288 - (19%)
Similarity:106/288 - (36%) Gaps:66/288 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 LTCATWEDMPYLVWRPD-----GSGSFVGIEGALLQFMAENLNFTV-------GLYWMNKEEVLA 264
            |...|..:.||::.:..     |:..|.|....||:.:|..|.|:.       |.|...      
Zfish   429 LVITTILEEPYVMLKKSDKALVGNDRFEGFCIDLLKELASILGFSYEIHLVPDGKYGFQ------ 487

  Fly   265 TFDESGR---IFDEIFGHHADFSLGGFHFKPSAGSEIPYSQSTYYFMSHIMLVTNLQSAY----- 321
              |:.|:   :..|:..|.||.::        |...|.:.:......|...|.|.:...|     
Zfish   488 --DDKGQWNGMIRELMEHRADLAV--------APLTITFMREKAIDFSKPFLNTGISILYRKPNS 542

  Fly   322 --SAYEKLSFPFTPLLWRAIGLVLI-LACLLLMLL----VRWRHHHELPRNPYYELL-------- 371
              |.:.....|.||.:|..|.|..: ::|:|.::.    ..|...|  |.||..:::        
Zfish   543 TNSGFFSFLNPMTPDIWVYILLAYLGVSCVLFVIARFSPYEWYDAH--PCNPGSDVVENNFTLLN 605

  Fly   372 --------VLTMGGNLEDRWVPQRFPSRLVLLTWLFATLVLRSGYQSGMYQLLRQDTQRNPPQTI 428
                    ::..|..|    :|:...:|::...|.|.||::.|.|.:.:...|..:...:|..:.
Zfish   606 SFWFGVGSLMQQGSEL----MPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMDSPVDSA 666

  Fly   429 SEVLAQHFTIQLAEVNEARILASLPELR 456
            .: ||:...|:...|.:...::...:.|
Zfish   667 DD-LAKQTKIEYGVVKDGATMSFFKKSR 693



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591815
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.