DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1409 and TXR1

DIOPT Version :10

Sequence 1:NP_572409.2 Gene:CG1409 / 31689 FlyBaseID:FBgn0029964 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_567078.1 Gene:TXR1 / 825097 AraportID:AT3G59280 Length:116 Species:Arabidopsis thaliana


Alignment Length:108 Identity:43/108 - (39%)
Similarity:64/108 - (59%) Gaps:7/108 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RYLAQIIILGAQLVGRALVKTMRQELQAFEDAARLQETLKANDPNSGRSAVAKTMTLAEAQQILD 67
            |.||.:|::|:.::|||:.:..||.|.....:...||.::    |..|.| .|.:|..||:|||.
plant     4 RLLANLIVMGSGIIGRAVFQAYRQALANASKSGVAQEAMQ----NGVRQA-GKAITEQEARQILG 63

  Fly    68 VSDLTNRQAIDTHYQHLFRVNDKSTGGSFYIQSKVFRAKERID 110
            |::.|:.:.|...|..||..|.|:  ||||:||||.||||.::
plant    64 VTEKTSWEEILQKYDKLFENNAKA--GSFYLQSKVHRAKECLE 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1409NP_572409.2 DnaJ 1..113 CDD:413365 43/108 (40%)
TXR1NP_567078.1 DnaJ 1..110 CDD:413365 43/108 (40%)

Return to query results.
Submit another query.