DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1409 and Pam16

DIOPT Version :9

Sequence 1:NP_572409.2 Gene:CG1409 / 31689 FlyBaseID:FBgn0029964 Length:150 Species:Drosophila melanogaster
Sequence 2:XP_038942745.1 Gene:Pam16 / 679907 RGDID:1598163 Length:244 Species:Rattus norvegicus


Alignment Length:115 Identity:58/115 - (50%)
Similarity:79/115 - (68%) Gaps:10/115 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ARYLAQIIILGAQLVGRALVKTMRQELQAFEDAARLQETLKANDPNSGRSAVAKT---MTLAEAQ 63
            |:||||||::|.|:||||..:.:|||..|.:.||      .|......:||.|..   ::|.|||
  Rat   121 AKYLAQIIVMGVQVVGRAFARALRQEFAASQAAA------DARGRAGHQSAAASNLSGLSLQEAQ 179

  Fly    64 QILDVSDLTNRQAIDTHYQHLFRVNDKSTGGSFYIQSKVFRAKERIDQEL 113
            |||::|.|:..: :..:|:|||:|||||.|||||:||||.|||||:|:||
  Rat   180 QILNISKLSPEE-VQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEEL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1409NP_572409.2 DnaJ 1..113 CDD:295354 56/113 (50%)
Pam16XP_038942745.1 Pam16 121..244 CDD:252088 58/115 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340555
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3442
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58071
OrthoDB 1 1.010 - - D1640138at2759
OrthoFinder 1 1.000 - - FOG0003224
OrthoInspector 1 1.000 - - mtm9139
orthoMCL 1 0.900 - - OOG6_102816
Panther 1 1.100 - - O PTHR12388
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3144
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.720

Return to query results.
Submit another query.