DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1409 and Pam16

DIOPT Version :9

Sequence 1:NP_572409.2 Gene:CG1409 / 31689 FlyBaseID:FBgn0029964 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_079847.1 Gene:Pam16 / 66449 MGIID:1913699 Length:125 Species:Mus musculus


Alignment Length:153 Identity:67/153 - (43%)
Similarity:90/153 - (58%) Gaps:32/153 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARYLAQIIILGAQLVGRALVKTMRQELQAFEDAARLQETLKANDPNSGRSAVAKT---MTLAEA 62
            ||:||||||::|.|:||||..:.:|||..|.:.||      .|......:||.|..   ::|.||
Mouse     1 MAKYLAQIIVMGVQVVGRAFARALRQEFAASQAAA------DARGRAGHQSAAASNLSGLSLQEA 59

  Fly    63 QQILDVSDLTNRQAIDTHYQHLFRVNDKSTGGSFYIQSKVFRAKERIDQELERTELLVKTDDSHS 127
            ||||:||.|:..: :..:|:|||:|||||.|||||:||||.|||||:|:||.             
Mouse    60 QQILNVSKLSPEE-VQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELR------------- 110

  Fly   128 ILPTPPESSQFQCENKEPGQKSR 150
                    .|.| |::|.|||.:
Mouse   111 --------IQAQ-EDREKGQKPK 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1409NP_572409.2 DnaJ 1..113 CDD:295354 58/114 (51%)
Pam16NP_079847.1 Pam16 1..125 CDD:252088 67/153 (44%)
J-like 58..110 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836849
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3442
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58071
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003224
OrthoInspector 1 1.000 - - otm43960
orthoMCL 1 0.900 - - OOG6_102816
Panther 1 1.100 - - O PTHR12388
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3144
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.710

Return to query results.
Submit another query.