DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1409 and PAM16

DIOPT Version :9

Sequence 1:NP_572409.2 Gene:CG1409 / 31689 FlyBaseID:FBgn0029964 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_057153.8 Gene:PAM16 / 51025 HGNCID:29679 Length:125 Species:Homo sapiens


Alignment Length:117 Identity:61/117 - (52%)
Similarity:80/117 - (68%) Gaps:10/117 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARYLAQIIILGAQLVGRALVKTMRQELQAFEDAARLQETLKANDPNSGRSAVAKT---MTLAEA 62
            ||:||||||::|.|:||||..:.:|||..|...||      .|......|||.|..   ::|.||
Human     1 MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAA------DARGRAGHRSAAASNLSGLSLQEA 59

  Fly    63 QQILDVSDLTNRQAIDTHYQHLFRVNDKSTGGSFYIQSKVFRAKERIDQELE 114
            ||||:||.|:..: :..:|:|||:|||||.|||||:||||.|||||:|:||:
Human    60 QQILNVSKLSPEE-VQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELK 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1409NP_572409.2 DnaJ 1..113 CDD:295354 59/114 (52%)
PAM16NP_057153.8 Pam16 1..125 CDD:252088 61/117 (52%)
J-like 58..110 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146901
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3442
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58071
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003224
OrthoInspector 1 1.000 - - otm41912
orthoMCL 1 0.900 - - OOG6_102816
Panther 1 1.100 - - O PTHR12388
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3144
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.710

Return to query results.
Submit another query.