DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1409 and pam16

DIOPT Version :9

Sequence 1:NP_572409.2 Gene:CG1409 / 31689 FlyBaseID:FBgn0029964 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_957098.2 Gene:pam16 / 393777 ZFINID:ZDB-GENE-040426-1776 Length:129 Species:Danio rerio


Alignment Length:117 Identity:63/117 - (53%)
Similarity:83/117 - (70%) Gaps:12/117 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARYLAQIIILGAQLVGRALVKTMRQELQAFEDAARLQETLKANDPNSGRSAVAKT----MTLAE 61
            ||:||||||::|||:||||..:.:|||..|.:.||..:       ..:||.:.|.:    |||.|
Zfish     1 MAKYLAQIIVMGAQVVGRAFARALRQEFAASQAAAEAR-------GQAGRQSAAASSFTGMTLQE 58

  Fly    62 AQQILDVSDLTNRQAIDTHYQHLFRVNDKSTGGSFYIQSKVFRAKERIDQEL 113
            |||||::|.||..: |..:|:|||:||||:.||||||||||.|||||:|:||
Zfish    59 AQQILNISTLTPEE-IQKNYEHLFKVNDKAVGGSFYIQSKVVRAKERLDEEL 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1409NP_572409.2 DnaJ 1..113 CDD:295354 61/115 (53%)
pam16NP_957098.2 DnaJ 1..118 CDD:295354 63/117 (54%)
J-like 58..110 36/53 (68%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..129 63/117 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580358
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58071
OrthoDB 1 1.010 - - D1640138at2759
OrthoFinder 1 1.000 - - FOG0003224
OrthoInspector 1 1.000 - - otm25154
orthoMCL 1 0.900 - - OOG6_102816
Panther 1 1.100 - - O PTHR12388
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3144
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.