DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1409 and tim16

DIOPT Version :9

Sequence 1:NP_572409.2 Gene:CG1409 / 31689 FlyBaseID:FBgn0029964 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_595349.1 Gene:tim16 / 2541152 PomBaseID:SPBC713.10 Length:128 Species:Schizosaccharomyces pombe


Alignment Length:145 Identity:42/145 - (28%)
Similarity:74/145 - (51%) Gaps:29/145 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARYLAQIIILGAQLVGRALVKTMRQELQAFEDAARLQETLKANDPNSGRSAVAKT--------M 57
            :.|.:.:.||:|:|::.:|.|:..:|.:            ..|...::|::|.:|:        |
pombe     3 LPRAVGRFIIVGSQVMSKAFVQAYKQMI------------ANAAQQSTGQAAASKSSTAVRRGEM 55

  Fly    58 TLAEAQQILDVS-DLTNRQAIDTHYQHLFRVNDKSTGGSFYIQSKVFRAKERIDQELERTELLVK 121
            |:.||..||::. :......::..:|.:|.:||...|||||:|||||||.|::..||::     |
pombe    56 TIQEAGSILNIKPESLEEGELEKRFQKMFEINDPKKGGSFYLQSKVFRAHEKLKSELDQ-----K 115

  Fly   122 TDDSHSILPTPPESS 136
            ..:..   |..|.||
pombe   116 IQEQS---PAKPTSS 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1409NP_572409.2 DnaJ 1..113 CDD:295354 35/120 (29%)
tim16NP_595349.1 DnaJ 5..119 CDD:295354 38/130 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 79 1.000 Domainoid score I2357
eggNOG 1 0.900 - - E1_KOG3442
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I1838
OMA 1 1.010 - - QHG58071
OrthoFinder 1 1.000 - - FOG0003224
OrthoInspector 1 1.000 - - otm47365
orthoMCL 1 0.900 - - OOG6_102816
Panther 1 1.100 - - O PTHR12388
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3144
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.