DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and ACA7

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_172287.1 Gene:ACA7 / 837326 AraportID:AT1G08080 Length:275 Species:Arabidopsis thaliana


Alignment Length:313 Identity:76/313 - (24%)
Similarity:133/313 - (42%) Gaps:70/313 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 HHTSFCCSTAGFIACSAIVLLCS--------SEVLSSWEEWWTYDGISGPSFWGLINPQWNMCNK 62
            :::|..|  ..|:|..:|..:.|        .||....|..:..:...||..||.:.|:|.||.|
plant     3 NYSSISC--IFFVALFSIFTIVSISSAASSHGEVEDEREFNYKKNDEKGPERWGELKPEWEMCGK 65

  Fly    63 GRRQSPIDVVPDKLLFDPYLRPLHIDKHKVSGTLHNTGQSLVFRVDKDTKQHVNISGGPLAYRYQ 127
            |..|||||::.:::....:|..|:.|.:..:.||.|.|..::.:.: |....:.|:|    :.|:
plant    66 GEMQSPIDLMNERVNIVSHLGRLNRDYNPSNATLKNRGHDIMLKFE-DGAGTIKING----FEYE 125

  Fly   128 FEEIYIHYGTENVRGSEHFIQGYSFPGEIQIYGFNKELYHNMSEAQHKSQGIVGLSLMVQIGETP 192
            .::::.|      ..|||.|.|..|..|:          |.:.|.:::...:|  :::.:||.  
plant   126 LQQLHWH------SPSEHTINGRRFALEL----------HMVHEGRNRRMAVV--TVLYKIGR-- 170

  Fly   193 NPELRIITSTFNKVLYR---------------GFSTPIRHISVRSLLPNTDHYITYEGSTTHPGC 242
                   ..||.:.|.:               |...|.: |.:.|     ..|..|.||.|.|.|
plant   171 -------ADTFIRSLEKELEGIAEMEEAEKNVGMIDPTK-IKIGS-----RKYYRYTGSLTTPPC 222

  Fly   243 WESTVWIIVNKPIYITKQELYQLRRLMQGSESTPKAPLGNNARPVQSLHHRTV 295
            .::..|.:|.|...:|::::..||..:....:       :||||||..:.|.|
plant   223 TQNVTWSVVRKVRTVTRKQVKLLRVAVHDDAN-------SNARPVQPTNKRIV 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 67/265 (25%)
ACA7NP_172287.1 alpha_CA_prokaryotic_like 49..270 CDD:239398 67/265 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.