DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and ACA5

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_172285.2 Gene:ACA5 / 837324 AraportID:AT1G08065 Length:277 Species:Arabidopsis thaliana


Alignment Length:331 Identity:78/331 - (23%)
Similarity:137/331 - (41%) Gaps:69/331 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSPGHHTSFCCSTAGFIACSAIVLLCSS----EVLSSWEEWWTYDGISGPSFWGLINPQWNMCN 61
            :||.|:        ..|:...:|.::.||    ||....:..:...|..||..||.:.|:|.||.
plant     3 IPSIGY--------VFFLIFISITIVSSSPDHGEVEDETQFNYEKKGEKGPENWGRLKPEWAMCG 59

  Fly    62 KGRRQSPIDVVPDKLLFD---PYLRPLHIDKHKVSGTLHNTGQSLVFRVD-KDTKQHVNISGGPL 122
            ||..|||||:...::|.|   .|||..::..   :.|:.|.|..::.:.: .:....:.|:|   
plant    60 KGNMQSPIDLTDKRVLIDHNLGYLRSQYLPS---NATIKNRGHDIMMKFEGGNAGLGITING--- 118

  Fly   123 AYRYQFEEIYIHYGTENVRGSEHFIQGYSFPGEIQIYGFNKELYHNMSEAQHKSQGIVGLSLMVQ 187
             ..|:.::|:.|      ..|||.:.|..|..|       :.:.|...:.::     ..::...:
plant   119 -TEYKLQQIHWH------SPSEHTLNGKRFVLE-------EHMVHQSKDGRN-----AVVAFFYK 164

  Fly   188 IGETPNPELRIITSTFNKVLYRGFSTPIRHISVRSLLPNT-----DHYITYEGSTTHPGCWESTV 247
            :|:   |:..::  |..:.|.|...|......|..:.|.|     .||..:.||.|.|.|.|:.:
plant   165 LGK---PDYFLL--TLERYLKRITDTHESQEFVEMVHPRTFGFESKHYYRFIGSLTTPPCSENVI 224

  Fly   248 WIIVNKPIYITKQELYQLRRLMQGSESTPKAPLGNNARPVQSLHHRTVRTNIDFKRNKNQYACPS 312
            |.|..:...:|.::|..||..:....:       :||||:|..:.|.|...|           |:
plant   225 WTISKEMRTVTLKQLIMLRVTVHDQSN-------SNARPLQRKNERPVALYI-----------PT 271

  Fly   313 MYKDMY 318
            .:..:|
plant   272 WHSKLY 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 65/262 (25%)
ACA5NP_172285.2 PLN02179 9..231 CDD:177835 61/251 (24%)
alpha_CA_prokaryotic_like 44..265 CDD:239398 64/257 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.