DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and ACA8

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_200444.1 Gene:ACA8 / 835733 AraportID:AT5G56330 Length:350 Species:Arabidopsis thaliana


Alignment Length:272 Identity:66/272 - (24%)
Similarity:102/272 - (37%) Gaps:89/272 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EEWWTYD--GISGPSFWGLINPQWNMCNKGRRQSPID------VVPDK--LLFDPYLRPLHIDKH 90
            |..::|:  |..||:.||.::.:|.||..|:.|||||      ||.:|  ||...||        
plant   137 ETEFSYETKGNKGPAKWGTLDAEWKMCGIGKMQSPIDLRDKNVVVSNKFGLLRSQYL-------- 193

  Fly    91 KVSGTLHNTGQSLVFRVDKDTKQ-HVNISGGPLAYRYQFEEIYIHYGTENVRGSEHFIQGYSFPG 154
            ..:.|:.|.|..::.:.....|. .|.|.|    .|||.::::.|      ..|||.|.|..|..
plant   194 PSNTTIKNRGHDIMLKFKGGNKGIGVTIRG----TRYQLQQLHWH------SPSEHTINGKRFAL 248

  Fly   155 EIQIYGFNKELYHNMSEAQHKSQGIVGLSLMVQIGETPNPELRIITSTFNKVLYR-GFSTPIRHI 218
            |          .|.:.|::.|...:|..                        ||. |.|.|....
plant   249 E----------EHLVHESKDKRYAVVAF------------------------LYNLGASDPFLFS 279

  Fly   219 SVRSLLPNTDHYITYEGSTTHPGCWESTVWIIVNKPIYITKQELYQLRRLMQGSESTPKAPLGNN 283
            ..:.|...||         ||..  |..:..:.:|.:.:.:..::      ..|:|        |
plant   280 LEKQLKKITD---------THAS--EEHIRTVSSKQVKLLRVAVH------DASDS--------N 319

  Fly   284 ARPVQSLHHRTV 295
            |||:|:::.|.|
plant   320 ARPLQAVNKRKV 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 63/260 (24%)
ACA8NP_200444.1 alpha_CA_prokaryotic_like 149..333 CDD:239398 63/260 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.