DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and ACA3

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_196038.1 Gene:ACA3 / 830296 AraportID:AT5G04180 Length:277 Species:Arabidopsis thaliana


Alignment Length:288 Identity:72/288 - (25%)
Similarity:116/288 - (40%) Gaps:57/288 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LCSSEVLSSWEEWWTY--DGISGPSFWGLINPQWNMCNKGRRQSPIDVVPDKL---------LFD 79
            |.||.:....|..:.|  ..|:.||.|..|..:|.:|..|:|||||::.| |:         :..
plant    13 LSSSSLADETETEFHYKPGEIADPSKWSSIKAEWKICGTGKRQSPINLTP-KIARIVHNSTEILQ 76

  Fly    80 PYLRPLHIDKHKVSGTLHNTGQSLVFRVDKDT-KQHVNISGGPLAYRYQFEEIYIHYGTENVRGS 143
            .|.:|       |...|.|.|..:..:.:.|. |..:|.:.      |:..:.:.|      ..|
plant    77 TYYKP-------VEAILKNRGFDMKVKWEDDAGKIVINDTD------YKLVQSHWH------APS 122

  Fly   144 EHFIQGYSFPGEIQIYGFNKELYHNMSEAQHKS-QG-IVGLSLMVQIGETPNPELRIITSTFNKV 206
            |||:.|.....|:.:.              ||| :| :..:.::.:.|| ||..:..|....:|:
plant   123 EHFLDGQRLAMELHMV--------------HKSVEGHLAVIGVLFREGE-PNAFISRIMDKIHKI 172

  Fly   207 L-YRGFSTPIRHISVRSLLPNTDHYITYEGSTTHPGCWESTVWIIVNKPIYITKQELYQLRRLMQ 270
            . .:.....|..|..|....:...:..|.||.|.|.|.|..:|.|:||...::::::..|....:
plant   173 ADVQDGEVSIGKIDPREFGWDLTKFYEYRGSLTTPPCTEDVMWTIINKVGTVSREQIDVLTDARR 237

  Fly   271 GSESTPKAPLGNNARPVQSLHHRTVRTN 298
            |...       .||||.|.|:.|.|..|
plant   238 GGYE-------KNARPAQPLNGRLVYLN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 66/266 (25%)
ACA3NP_196038.1 alpha_CA_prokaryotic_like 35..257 CDD:239398 65/263 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.