DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and ACA6

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_193832.1 Gene:ACA6 / 827847 AraportID:AT4G21000 Length:260 Species:Arabidopsis thaliana


Alignment Length:223 Identity:56/223 - (25%)
Similarity:99/223 - (44%) Gaps:51/223 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GPSFWGLINPQWNMCNKGRRQSPIDVVPDK--LLFDPYLRPLHIDKH--KVSGTLHNTGQSLVFR 106
            ||:.||.::|||.:|:.|:.|||||:..::  |:.|..|     .||  ..|..:.:.|..::..
plant    46 GPAEWGKLDPQWKVCSTGKIQSPIDLTDERVSLIHDQAL-----SKHYKPASAVIQSRGHDVMVS 105

  Fly   107 VDKDTKQHVNISGGPLA-YRYQFEEIYIHYGTENVRGSEHFIQGYSFPGEIQIYGFNKELYHNMS 170
            ...|        ||.:. ::..::.:..|:.:.    |||.|.|.|         ::.||:...:
plant   106 WKGD--------GGKITIHQTDYKLVQCHWHSP----SEHTINGTS---------YDLELHMVHT 149

  Fly   171 EAQHKSQGIVGLSLMVQIGETPNPELRIITSTFN-------KVLYRGFSTPIRHISVRSLLPNTD 228
            .|..|:. :||  ::.::||   |: ..:|...|       |.:..|...|      |.:...|:
plant   150 SASGKTT-VVG--VLYKLGE---PD-EFLTKILNGIKGVGKKEIDLGIVDP------RDIRFETN 201

  Fly   229 HYITYEGSTTHPGCWESTVWIIVNKPIY 256
            ::..|.||.|.|.|.|..:|.:..:.:|
plant   202 NFYRYIGSLTIPPCTEGVIWTVQKRVLY 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 56/223 (25%)
ACA6NP_193832.1 PLN02179 1..235 CDD:177835 56/223 (25%)
alpha_CA_prokaryotic_like 46..225 CDD:239398 55/217 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.