DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and ACA2

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001318303.1 Gene:ACA2 / 817367 AraportID:AT2G28210 Length:276 Species:Arabidopsis thaliana


Alignment Length:296 Identity:68/296 - (22%)
Similarity:133/296 - (44%) Gaps:49/296 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IACSAIVLLCS--------------SEVLSSWEEWWTYDGISGPSFWGLINPQWNMCNKGRRQSP 68
            |.|...::|.|              .||....|..:.::..:||:.||.:.|:|.||.||..|||
plant     6 IRCFIFLVLTSFVTTVSCLSAATDYREVEDEHEFSYEWNQENGPAKWGKLRPEWKMCGKGEMQSP 70

  Fly    69 IDVVPDKLLFDPYLRPLHIDKHKVSGTLHNTGQSLVFRVDKDTKQHVNISGGPLAYRYQFEEIYI 133
            ||::..::....:|:.|.......:.||.|.|..::.:..::....:.::|      .:::.:.:
plant    71 IDLMNKRVRLVTHLKKLTRHYKPCNATLKNRGHDMMLKFGEEGSGSITVNG------TEYKLLQL 129

  Fly   134 HYGTENVRGSEHFIQGYSFPGEIQIYGFNKELYHNMSEAQHKSQGIVGLSLMVQIGETPNPELRI 198
            |:.:.    |||.:.|..|..|:          |.:.|..:.|..:|  :::.:||. |:..|.:
plant   130 HWHSP----SEHTMNGRRFALEL----------HMVHENINGSLAVV--TVLYKIGR-PDSFLGL 177

  Fly   199 ITSTFNKVLYRGFSTPIRHISV---RSLLPNTDHYITYEGSTTHPGCWESTVWIIVNKPIYITKQ 260
            :.:..:.:..:..:.  :::.|   |.:...:..:..|.||.|.|.|.::.:|.:|.|...:||.
plant   178 LENKLSAITDQNEAE--KYVDVIDPRDIKIGSRKFYRYIGSLTTPPCTQNVIWTVVKKVRTVTKN 240

  Fly   261 ELYQLRRLMQGSESTPKAPLGNNARPVQSLHHRTVR 296
            ::..||..:..:..|       ||||||..:.|.|:
plant   241 QVKLLRVAVHDNSDT-------NARPVQPTNKRVVK 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 61/254 (24%)
ACA2NP_001318303.1 alpha_CA_prokaryotic_like 48..270 CDD:239398 61/254 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.