DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and car1_predicted

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001072785.1 Gene:car1_predicted / 780246 -ID:- Length:258 Species:Xenopus tropicalis


Alignment Length:252 Identity:79/252 - (31%)
Similarity:126/252 - (50%) Gaps:16/252 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 QSPIDVVPDKLLFDPYLRPLHID-KHKVSGTLHNTGQSLVFRVD-KDTKQHVNISGGPLAYRYQF 128
            ||||::......::|.|:||... ..|.:..:.|.|.  .|.|: :|......:|.|||...|:.
 Frog    16 QSPININTRTAKYNPSLKPLKFSYDPKTAKRIVNVGH--CFNVEFEDICDKSVLSEGPLDGHYRL 78

  Fly   129 EEIYIHYGTENVRGSEHFIQGYSFPGEIQIYGFNKELYHNMSEAQHKSQGIVGLSLMVQIGETPN 193
            .:.:.|:|:.:..||||.|.|:.:|.|:.|..:|.:.|.:.:||.....|:..:.:.:::|.| |
 Frog    79 CQFHFHWGSSDRDGSEHNIDGHLYPAELHIVHWNSKKYTSFAEAAKHPDGVAVVGVFLKLGNT-N 142

  Fly   194 PELRIITSTFNKVLYRGFSTPIRHISVRSLLPNTDHYITYEGSTTHPGCWESTVWIIVNKPIYIT 258
            |.|:.|....:||..:|.:.|.....:..|||...:|.||.||.|....:|...|||:.:.|.::
 Frog   143 PALQSIIENLDKVKTKGKACPFTEFHLNGLLPEDLNYWTYMGSLTTKPYFECVTWIILQEAITVS 207

  Fly   259 KQELYQLRRLMQGSESTPKAPLGNNARPVQSLHHRTVRTNIDFKRNKNQYACPSMYK 315
            .|:|.|.|||...||:...:.:..|.||||.|.||.|.:           :||..:|
 Frog   208 SQQLEQFRRLQCTSENENPSFILENHRPVQPLDHRVVYS-----------SCPVKHK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 76/235 (32%)
car1_predictedNP_001072785.1 alpha_CA 16..247 CDD:381753 76/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.