DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and CA6

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_011540386.1 Gene:CA6 / 765 HGNCID:1380 Length:324 Species:Homo sapiens


Alignment Length:309 Identity:82/309 - (26%)
Similarity:145/309 - (46%) Gaps:33/309 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CSTAGFIACSAIVLLCSSEVLSSWEEW---WTY-DGISGPSFWGLINPQWNMCNKGRRQSPIDVV 72
            |||     ..|:|||.|..:|....:.   ||| :|....:.|    ||......|:|||||::.
Human     2 CST-----MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHW----PQHYPACGGQRQSPINLQ 57

  Fly    73 PDKLLFDPYLRPLHIDKHKVSG---TLHNTGQSLVFRVDKDTKQHVNISGGPLAYRYQFEEIYIH 134
            ..|:.::|.|:.|::..::...   .:.|.|.::  ::...:...:.::.|.:   |..::::.|
Human    58 RTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTV--QISLPSTMRMTVADGTV---YIAQQMHFH 117

  Fly   135 YG--TENVRGSEHFIQGYSFPGEIQIYGFNKELYHNMSEAQHKSQGIVGLSLMVQIGETP-NPEL 196
            :|  :..:.||||.:.|.....||.|..:|.: |.:...||....|:..|:..|::...| |...
Human   118 WGGASSEISGSEHTVDGIRHVIEIHIVHYNSK-YKSYDIAQDAPDGLAVLAAFVEVKNYPENTYY 181

  Fly   197 RIITSTFNKVLYRGFSTPIRHISVRSLLP-NTDHYITYEGSTTHPGCWESTVWIIVNKPIYITKQ 260
            ....|....:.|.|..|.:..:.|:.:|| |..||.||.||.|.|.|.|:..|.::...:.:::.
Human   182 SNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRT 246

  Fly   261 ELYQLRR-LMQGSESTPKAPLGNNARPVQSLHHRTVRTNIDFKRNKNQY 308
            ::::|.. |:.....|    :.|:.|..|.|:||.|.:|  |...:|.|
Human   247 QVWKLENSLLDHRNKT----IHNDYRRTQPLNHRVVESN--FPNQENAY 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 66/261 (25%)
CA6XP_011540386.1 alpha_CA_VI 35..283 CDD:239399 66/263 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.