DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and CA5A

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_011521611.1 Gene:CA5A / 763 HGNCID:1377 Length:376 Species:Homo sapiens


Alignment Length:173 Identity:48/173 - (27%)
Similarity:84/173 - (48%) Gaps:23/173 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 WEEWWTYDGISGPSFW------------GLINPQWNM---CNKGRRQSPIDVVPDKLLFDPYLRP 84
            |...|:..  ..|..|            ..::|.|.:   ...|.|||||::.....::||.|:|
Human    20 WAPLWSRS--MRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKP 82

  Fly    85 LHIDKHKVSGTLH--NTGQSLVFRVD-KDTKQHVNISGGPLAYRYQFEEIYIHYGTENVRGSEHF 146
            |.: .::.:..|:  |||  .:|:|: .|..:...||||||...|:.::.:.|:|..|..||||.
Human    83 LRV-SYEAASCLYIWNTG--YLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHT 144

  Fly   147 IQGYSFPGEIQIYGFNKELYHNMSEAQHKSQGIVGLSLMVQIG 189
            :.|:::|.|:.:..:|...|.|..||.....|:..:.:.:::|
Human   145 VDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLG 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 46/162 (28%)
CA5AXP_011521611.1 alpha_CA 61..>212 CDD:294017 42/130 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.