DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and CA3

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_005172.1 Gene:CA3 / 761 HGNCID:1374 Length:260 Species:Homo sapiens


Alignment Length:267 Identity:80/267 - (29%)
Similarity:135/267 - (50%) Gaps:14/267 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 WTYDGISGPSFWGLINPQWNMCNKGRRQSPIDVVPDKLLFDPYLRPLHIDKHKVSG-TLHNTGQS 102
            |.|...:||..|..:.|.    .||..|||:::....:..||.|:|..:.....|. |:.|.|::
Human     5 WGYASHNGPDHWHELFPN----AKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKT 65

  Fly   103 --LVFRVDKDTKQHVNISGGPLAYRYQFEEIYIHYGTENVRGSEHFIQGYSFPGEIQIYGFNKEL 165
              :||   .||.....:.||||...|:..:.::|:|:.:..||||.:.|..:..|:.:..:|.: 
Human    66 CRVVF---DDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPK- 126

  Fly   166 YHNMSEAQHKSQGIVGLSLMVQIGETPNPELRIITSTFNKVLYRGFSTPIRHISVRSLLPNTDHY 230
            |:...||..:..||..:.:.::||. .|.|.:|.....:|:..:|...|........|.|....|
Human   127 YNTFKEALKQRDGIAVIGIFLKIGH-ENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDY 190

  Fly   231 ITYEGSTTHPGCWESTVWIIVNKPIYITKQELYQLRRLMQGSESTPKAPLGNNARPVQSLHHRTV 295
            .||:||.|.|.|.|..||:::.:|:.::..::.:||.|:..:|:.|..||.:|.||.|.:::|.|
Human   191 WTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVV 255

  Fly   296 RTNIDFK 302
            |.:  ||
Human   256 RAS--FK 260

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 76/256 (30%)
CA3NP_005172.1 alpha_CA_I_II_III_XIII 1..259 CDD:239393 78/264 (30%)
Involved in proton transfer 64..67 0/2 (0%)