DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and CA2

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_000058.1 Gene:CA2 / 760 HGNCID:1373 Length:260 Species:Homo sapiens


Alignment Length:265 Identity:72/265 - (27%)
Similarity:131/265 - (49%) Gaps:10/265 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 WTYDGISGPSFWGLINPQWNMCNKGRRQSPIDVVPDKLLFDPYLRPLHIDKHKVSG-TLHNTGQS 102
            |.|...:||..|....|    ..||.||||:|:......:||.|:||.:...:.:. .:.|.|.:
Human     5 WGYGKHNGPEHWHKDFP----IAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHA 65

  Fly   103 LVFRVDKDTKQHVNISGGPLAYRYQFEEIYIHYGTENVRGSEHFIQGYSFPGEIQIYGFNKELYH 167
            .....| |::....:.||||...|:..:.:.|:|:.:.:||||.:....:..|:.:..:|.: |.
Human    66 FNVEFD-DSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTK-YG 128

  Fly   168 NMSEAQHKSQGIVGLSLMVQIGETPNPELRIITSTFNKVLYRGFSTPIRHISVRSLLPNTDHYIT 232
            :..:|..:..|:..|.:.:::| :..|.|:.:....:.:..:|.|....:...|.|||.:..|.|
Human   129 DFGKAVQQPDGLAVLGIFLKVG-SAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWT 192

  Fly   233 YEGSTTHPGCWESTVWIIVNKPIYITKQELYQLRRLMQGSESTPKAPLGNNARPVQSLHHRTVRT 297
            |.||.|.|...|...||::.:||.::.:::.:.|:|....|..|:..:.:|.||.|.|.:|.::.
Human   193 YPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKA 257

  Fly   298 NIDFK 302
            :  ||
Human   258 S--FK 260

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 68/254 (27%)
CA2NP_000058.1 alpha_CA_I_II_III_XIII 1..259 CDD:239393 70/262 (27%)