DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and ca5b

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001039155.1 Gene:ca5b / 733981 XenbaseID:XB-GENE-1003819 Length:319 Species:Xenopus tropicalis


Alignment Length:275 Identity:76/275 - (27%)
Similarity:125/275 - (45%) Gaps:32/275 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 PQW---NMCN------------------------KGRRQSPIDVVPDKLLFDPYLRPLHIDKHKV 92
            |:|   .|||                        .|.|||||::.....:|.|.|.|:| .::..
 Frog    28 PRWVPARMCNISACSYKLRNVDLHPLWRGEIEVPGGSRQSPINIRIRDSVFHPQLAPVH-TQYDP 91

  Fly    93 SGTLH--NTGQSLVFRVDKDTKQHVNISGGPLAYRYQFEEIYIHYGTENVRGSEHFIQGYSFPGE 155
            :..|:  |.|.|.....| |:.....:|||||...::.::.:.|:|..|..||||.:....||.|
 Frog    92 NTCLYIWNNGYSFFVEYD-DSTDKSTVSGGPLENPFRLKQFHFHWGRNNDWGSEHTVDSRVFPAE 155

  Fly   156 IQIYGFNKELYHNMSEAQHKSQGIVGLSLMVQIGETPNPELRIITSTFNKVLYRGFSTPIRHISV 220
            :.:..:|...|....||..:..|:..:.:.:::|: .:.:|:.:......|.|:...|...:...
 Frog   156 LHLVHWNCSKYRTFEEAIMEPNGLAVIGVFLKVGK-HHEKLQKLVDILPSVRYKDALTEFNYFDS 219

  Fly   221 RSLLPNTDHYITYEGSTTHPGCWESTVWIIVNKPIYITKQELYQLRRLMQGSESTPKAPLGNNAR 285
            ..|||:...|.||.||.|.|...||..|||:.|||.:...:|...|.|:..:....:..:.:|.|
 Frog   220 SCLLPSCGDYWTYSGSLTTPPLTESVTWIIMKKPIEVDHSQLAVFRSLLFTAVGEEERYMVDNFR 284

  Fly   286 PVQSLHHRTVRTNID 300
            |:|.|.:|||.::.:
 Frog   285 PLQPLMNRTVHSSFE 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 76/273 (28%)
ca5bNP_001039155.1 alpha_CA_V 63..298 CDD:239392 71/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.