DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and ca5a

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001104671.1 Gene:ca5a / 569989 ZFINID:ZDB-GENE-080220-57 Length:310 Species:Danio rerio


Alignment Length:286 Identity:77/286 - (26%)
Similarity:126/286 - (44%) Gaps:26/286 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ACSAIVLLCSSEVLSSWEEWWTYDGISGPSFWGLINPQWN---MCNKGRRQSPIDVVPDKLLFDP 80
            ||:  :..|||::                |....::|.|.   ....|.||||||:...|.:|:|
Zfish    33 ACN--LTACSSKL----------------SILSQVHPMWQEPLAIPGGDRQSPIDIEVRKSIFNP 79

  Fly    81 YLRPLHID-KHKVSGTLHNTGQSLVFRVDKDTKQHVNISGGPLAYRYQFEEIYIHYGTENVRGSE 144
            .||||.:. ..:....:.|.|.|.:...| ||.....:.||||..:|:..:.:.|:|..|..|||
Zfish    80 QLRPLKVQYDPRTCQQIWNNGYSFLVEYD-DTTDKSTVKGGPLENQYRLCQFHFHWGENNNWGSE 143

  Fly   145 HFIQGYSFPGEIQIYGFNKELYHNMSEAQHKSQGIVGLSLMVQIGETPNPELRIITSTFNKVLYR 209
            |.|....:..|:.|..:|.:.|....||..:..|:..:.:.:::|:. :..|:.:......|.::
Zfish   144 HSIDRRLYAAELHIVHWNSDKYSLFEEAVMEENGLAVIGVFLKVGKR-HEGLQKLVDALPAVRHK 207

  Fly   210 GFSTPIRHISVRSLLP-NTDHYITYEGSTTHPGCWESTVWIIVNKPIYITKQELYQLRRLM-QGS 272
            .............||| |...|.||.||.|.|...|:..||::.:.|.::..:|...|.|: ..:
Zfish   208 DSVVEFNKFDPSCLLPENISDYWTYPGSLTTPPLTEAVTWIVMKQHIEVSHDQLAVFRSLLFTSA 272

  Fly   273 ESTPKAPLGNNARPVQSLHHRTVRTN 298
            |...:..:.||.|..|.|..|.|.::
Zfish   273 EEQVQRSMVNNFRVQQDLKGRAVHSS 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 72/259 (28%)
ca5aNP_001104671.1 alpha_CA 62..299 CDD:294017 69/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.