DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and CA10

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001076002.1 Gene:CA10 / 56934 HGNCID:1369 Length:328 Species:Homo sapiens


Alignment Length:323 Identity:127/323 - (39%)
Similarity:202/323 - (62%) Gaps:23/323 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AGFIACSAIVLLCSSEVLSSWEEWWTY-DGISG-----PSFWGLINPQWNMCNKGRRQSPIDVVP 73
            |.||.|    :..........|.||.| :.:.|     ||||||:|..||:|:.|:||||:::..
Human    13 ANFIVC----ISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIET 73

  Fly    74 DKLLFDPYLRPLHIDK--HKVSGTLHNTGQSLVFRVDKDTKQH-VNISGGPLAYRYQFEEIYIHY 135
            ..::|||:|.||.|:.  .|||||::|||:.:..|:|   |:| |||||||:.|.::.|||.:|:
Human    74 SHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLD---KEHLVNISGGPMTYSHRLEEIRLHF 135

  Fly   136 GTENVRGSEHFIQGYSFPGEIQIYGFNKELYHNMSEAQHKSQGIVGLSLMVQIGETPNPEL-RII 199
            |:|:.:||||.:.|.:|.||:|:..:|.|||.|::||.....|:|.:|:.:::.::.||.| |::
Human   136 GSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRML 200

  Fly   200 T-STFNKVLYRGFSTPIRHISVRSLLPNTDHYITYEGSTTHPGCWESTVWIIVNKPIYITKQELY 263
            . .|..::.|:..:..::.:::..|.|.|..:|||:||.|.|.|:|:..|||:|||:|||:.:::
Human   201 NRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMH 265

  Fly   264 QLRRLMQGSESTPKAPLGNNARPVQSLHHRTVRTNIDFK-RNKNQYACP-SMYKDMYYRANRW 324
            .||.|.|...|.....:.:|.||||.|::|.:||||:|. :.|:   || :..:.:.||.|.|
Human   266 SLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKD---CPNNRAQKLQYRVNEW 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 110/263 (42%)
CA10NP_001076002.1 alpha_CARP_X_XI_like 46..302 CDD:239395 109/258 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 234 1.000 Domainoid score I2391
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I3255
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45680
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0002299
OrthoInspector 1 1.000 - - mtm8599
orthoMCL 1 0.900 - - OOG6_106561
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1354
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.880

Return to query results.
Submit another query.