DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and ca9

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_009303384.1 Gene:ca9 / 566612 ZFINID:ZDB-GENE-080818-5 Length:384 Species:Danio rerio


Alignment Length:341 Identity:94/341 - (27%)
Similarity:151/341 - (44%) Gaps:40/341 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GFIACSAIVLL------CSSEVLSSWEEWWTYDGISGPSFWGLINPQ-W----NMCNKGRRQSPI 69
            ||:....:.||      .|.|..||..:.....|.|....||..:.. |    ..|. |:.||||
Zfish     4 GFLLILHLQLLLVASSSSSEEDKSSERDGQHSKGSSHQHHWGYQDQDAWLSAFEHCG-GKSQSPI 67

  Fly    70 DVVPDKLLFDPYLRPLHIDKHKVSG----TLHNTGQSLVFRVDKDTKQHVNISGGPLAYRYQFEE 130
            ::...|:|.:|.|.|:.:|.:.::|    ||.|.|.:|...:...           :..|..|::
Zfish    68 NIDTHKVLHEPRLPPIQLDGYDLTGSHSLTLLNNGHTLQLSLPSS-----------MRIRRGFDQ 121

  Fly   131 IYI------HYGTENVRGSEHFIQGYSFPGEIQIYGFNKELYHNMSEAQHKSQGIVGLSLMVQIG 189
            :|:      |:||..|.||||.|....:|.||.:..:|.: |.|::||..|:.|:..|...:.||
Zfish   122 VYVAAQLHFHWGTTEVPGSEHTIDNIHYPAEIHVVHYNSK-YANLTEAASKADGLAVLGGFIAIG 185

  Fly   190 ETPNPELRIITSTFNKVLYRGFSTPIRHISVRSLLPNT-DHYITYEGSTTHPGCWESTVWIIVNK 253
            ...|.....|.|..:.|......|.|...:||.||||: :.:..|.||.|.|.|.::..|.:.|.
Zfish   186 LHENDNYEKILSALSDVSTEESLTVIPGFNVRHLLPNSLERFYRYSGSLTTPPCLQTVSWTLFND 250

  Fly   254 PIYITKQELYQLRRLMQGSESTPKAPLGNNARPVQSLHHRTVRTNIDFK-RNKNQYACPSMYKDM 317
            .|.::::   ||..|.:..::.....|..|.|..|.||.|.::::.... ..|.:.|.|:..:|.
Zfish   251 SIRVSRR---QLAALEESLKTEHNKLLSKNFRAPQLLHGRKIQSSFHTSDSGKTRGATPTETQDK 312

  Fly   318 YYRANRWSPD-TGLLI 332
            ..:.:...|. ||.::
Zfish   313 NIKESSAHPSLTGHIL 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 77/269 (29%)
ca9XP_009303384.1 alpha_CA_IX 48..294 CDD:239403 75/261 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.