DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and ca8

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001017571.2 Gene:ca8 / 550233 ZFINID:ZDB-GENE-050417-26 Length:281 Species:Danio rerio


Alignment Length:274 Identity:88/274 - (32%)
Similarity:150/274 - (54%) Gaps:29/274 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EWWTYDGISGPSFWGLINPQWNMCNKGRRQSPIDVVPDKLLFDPYLRPLHIDKHKV---SGTLHN 98
            :|...:|:.    |||:.|:.|    |..||||::...:..:||.|..:.::.:.|   ...:.|
Zfish    19 DWGYEEGVE----WGLLFPEAN----GEYQSPINLNSREARYDPQLLDVGLNPNYVVCRDCEVIN 75

  Fly    99 TGQSLVFRVDKDTKQHVNISGGPLA--YRYQFEEIYIHYGTENVRGSEHFIQGYSFPGEIQIYGF 161
            .|.::  |:...:|..|  :||||.  :.|:..|:..|:|.||.|||||.:...:||.|:.:..:
Zfish    76 DGHTV--RIMLKSKSVV--TGGPLPSDHEYELSEVRFHWGKENQRGSEHTVNFKAFPMELHLIHW 136

  Fly   162 NKELYHNMSEAQHKSQGIVGLSLMVQIGETPNPELRIITSTFNKVLYRGFSTPIRHISVRSLLPN 226
            |..|::::.||..|.:||:.::|.||:|: .:..|:.||.....:.|:|.:..|...:..:|||:
Zfish   137 NSTLFNSVEEAMGKKRGILIIALFVQVGK-EHLGLKAITDVLQDLQYKGKTKIIPCFNPNTLLPD 200

  Fly   227 ---TDHYITYEGSTTHPGCWESTVWIIVNKPIYITKQELYQLRRL---MQGSESTPK---APLGN 282
               .|::: ||||.|.|.|.|:..||:...|:.|::.::.:.|||   ::|:| .|:   ..||:
Zfish   201 PLLRDYWV-YEGSLTTPPCSENVTWILYRYPLTISQMQIEEFRRLRSHVKGAE-LPEGNDGMLGD 263

  Fly   283 NARPVQSLHHRTVR 296
            |.||.|.|..|.||
Zfish   264 NFRPTQPLSDRVVR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 86/265 (32%)
ca8NP_001017571.2 alpha_CARP_VIII 25..280 CDD:239394 87/268 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.