DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and ca12

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001016431.1 Gene:ca12 / 549185 XenbaseID:XB-GENE-1015246 Length:335 Species:Xenopus tropicalis


Alignment Length:271 Identity:79/271 - (29%)
Similarity:133/271 - (49%) Gaps:21/271 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 WTYDGISGPSFWGLINPQ-WNMCNKGRRQSPIDVVPDKLLFDPYLRPLHIDKHKVSG----TLHN 98
            |.|.|..|...|    |: :..|. |..|||||:..|.|.:|..|:|:.::.:.||.    ||.|
 Frog    23 WAYIGTKGEKSW----PKNYEFCG-GVYQSPIDIHQDILQYDSSLQPVKLNGYNVSPAESFTLSN 82

  Fly    99 TGQSLVFRVDKDTKQHVNISGGPLAYRYQFEEIYIHYGTENV-RGSEHFIQGYSFPGEIQIYGFN 162
            .|.:    |.......:.|...|  :.|...::::|:|.... :||||.|:|..|.||:.:..:|
 Frog    83 NGHT----VQMSLVPTMQIKIAP--FHYTASQLHLHWGQRGTQKGSEHCIEGKRFAGEVHLVNYN 141

  Fly   163 KELYHNMSEAQHKSQGIVGLSLMVQIGETPNPELRIITSTFNKVLYRGFSTPIRHISVRSLLP-N 226
            .:.|.:::.|..:|.|:..|.:::::|.. ||....|.|..:.:.|:..|..|...:|:.||| .
 Frog   142 SDKYSDITTAMKESDGLAVLGILLEVGPF-NPTFEKIISQLHSIGYKDQSVQIAGFNVQELLPKR 205

  Fly   227 TDHYITYEGSTTHPGCWESTVWIIVNKPIYITKQELYQLRRLMQGSESTPKAPLGNNARPVQSLH 291
            .|.|..||||.|.|.|:.|.:|.:...|:.|::::|..|...:..::......:.||.|.:|...
 Frog   206 LDEYYRYEGSLTTPPCYPSVLWTVFRNPVTISEEQLITLETALYSTDRNESVQMTNNYRQLQPHG 270

  Fly   292 HRTVRTNIDFK 302
            .|.|  ::.|:
 Frog   271 DRLV--SVSFR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 75/260 (29%)
ca12NP_001016431.1 alpha_CA_XII_XIV 30..278 CDD:239400 75/261 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.