DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and Ca13

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001128465.1 Gene:Ca13 / 499566 RGDID:1560453 Length:262 Species:Rattus norvegicus


Alignment Length:262 Identity:91/262 - (34%)
Similarity:139/262 - (53%) Gaps:9/262 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 WTYDGISGPSFWGLINPQWNMCNKGRRQSPIDVVPDKLLFDPYLRPLHIDKHKVSG-TLHNTGQS 102
            |.||..:||..|..:.|    ...|.:||||::...::.:|..||||.|.....|. .:.|:|.|
  Rat     6 WGYDEHNGPIHWNELFP----IADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPASAKIISNSGHS 66

  Fly   103 LVFRVD-KDTKQHVNISGGPLAYRYQFEEIYIHYGTENVRGSEHFIQGYSFPGEIQIYGFNKELY 166
              |.|| .||:....:.||||...|:..:.::|:|:.:..||||.:.|..:..|:.:..:|.:.|
  Rat    67 --FNVDFDDTEDKSVLRGGPLTGSYRLRQFHLHWGSADDHGSEHVVDGVRYAAELHVVHWNSDKY 129

  Fly   167 HNMSEAQHKSQGIVGLSLMVQIGETPNPELRIITSTFNKVLYRGFSTPIRHISVRSLLPNTDHYI 231
            .:..||.|:|.|:..|.:.:|||| .||:|:.||...:.:..:|..|...:.....|||::..|.
  Rat   130 PSFVEAAHESDGLAVLGVFLQIGE-HNPQLQKITDILDSIKEKGKQTRFTNFDPLCLLPSSWDYW 193

  Fly   232 TYEGSTTHPGCWESTVWIIVNKPIYITKQELYQLRRLMQGSESTPKAPLGNNARPVQSLHHRTVR 296
            ||.||.|.|...||..||::.:||.|:.|:|.:.|.|:..:|....|.|.:|.||.|.|..|.||
  Rat   194 TYPGSLTVPPLLESVTWIVLKQPISISSQQLARFRSLLCTAEGESAAFLLSNHRPPQPLKGRRVR 258

  Fly   297 TN 298
            .:
  Rat   259 AS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 88/255 (35%)
Ca13NP_001128465.1 alpha_CA_I_II_III_XIII 2..261 CDD:239393 91/262 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.