DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and ca8

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001011213.1 Gene:ca8 / 496646 XenbaseID:XB-GENE-953676 Length:282 Species:Xenopus tropicalis


Alignment Length:285 Identity:88/285 - (30%)
Similarity:138/285 - (48%) Gaps:49/285 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EEWWTYDGISGPSFWGLINPQWNMCNKGRRQSPIDVVPDKLLFDPYLRPLHI------------- 87
            :||...:|:.    |||:.|:.|    |..||||::...:.::||.|..:.:             
 Frog    19 QEWGYEEGVE----WGLLYPEAN----GDYQSPININSREAMYDPSLLEVRLTPSYVVCRDCEVI 75

  Fly    88 -DKHKVSGTLHNTGQSLVFRVDKDTKQHVNISGGPL--AYRYQFEEIYIHYGTENVRGSEHFIQG 149
             |.|.|...|               |....:.||||  .:.|:..|:..|:|.||.|||||.:..
 Frog    76 NDGHVVQILL---------------KSKSVLKGGPLPRGHEYELNEVRFHWGKENQRGSEHTVNF 125

  Fly   150 YSFPGEIQIYGFNKELYHNMSEAQHKSQGIVGLSLMVQIGETPNPELRIITSTFNKVLYRGFSTP 214
            .:||.|:.:..:|..||.::.||..|..|||.:||.||||: .|..|:.||.....:.|:|.|..
 Frog   126 KAFPMELHLIHWNSTLYRSLEEAMGKVHGIVIISLFVQIGK-ENIGLKAITEVLQDIFYKGKSKT 189

  Fly   215 IRHISVRSLLPN---TDHYITYEGSTTHPGCWESTVWIIVNKPIYITKQELYQLRRL---MQGSE 273
            |...:..:|||:   .|::: ||||.|.|.|.|...||:...|:.:::.::.:.|||   ::|::
 Frog   190 IPCFNPNTLLPDPLLRDYWV-YEGSLTMPPCSEGVTWILFRYPLTVSQTQIEEFRRLRTHIKGAD 253

  Fly   274 STPKAP--LGNNARPVQSLHHRTVR 296
            ......  :.:|.||.|.|..|.:|
 Frog   254 LPDGCDGLMADNFRPTQPLSDRIIR 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 85/275 (31%)
ca8NP_001011213.1 alpha_CARP_VIII 26..281 CDD:239394 86/278 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.