DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and CAH6

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001097987.1 Gene:CAH6 / 43701 FlyBaseID:FBgn0039838 Length:298 Species:Drosophila melanogaster


Alignment Length:287 Identity:84/287 - (29%)
Similarity:133/287 - (46%) Gaps:57/287 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EEWWTYDGISGPSFWGLINPQWNMCNKGRRQSPID-------VVP-DKLLFDPY---LR-PLHID 88
            |..|.|: .:|.: ||      .:|:.|.|||||.       :|| .:::|..|   || ||   
  Fly    27 ESHWDYE-TNGQN-WG------GICSTGERQSPISLNVQKSLIVPLPRIVFGNYDVKLRGPL--- 80

  Fly    89 KHKVSGTLHNTGQSLVFRVDKDTKQHVN-ISGGPLAYRYQFEEIYIHYGTENVRGSEHFIQGYSF 152
                  ||.|.|.:....:.:....:.. |:||.|..|:..|..:.|:|:.:.|||||.|....|
  Fly    81 ------TLLNNGHTAHVEIPETANGNKPFITGGLLKGRFVAEAFHFHWGSPSSRGSEHSINQQRF 139

  Fly   153 PGEIQIYGFNKELYHNMSEAQHKSQGIVGLSLMVQIGETPN---PELRIITSTFNKVL-YRGFST 213
            ..|:.|...| |.|.::.||::|..||..:.:|::|.:.||   |.|..:.|...:|. |...:|
  Fly   140 DVEMHIVHRN-EKYGDIDEAKNKKDGIAVIGVMLKIVKNPNRIFPGLSKVMSALPRVTKYNAKTT 203

  Fly   214 PIRHISVRSLLPNTD--HYITYEGSTTHPGCWESTVWIIVNK--PI-YITKQELYQLR-----RL 268
            ....:|:..:|.|.:  .:.||.||.|.|.|.:|..|.:.::  |: |.:..:.::||     ||
  Fly   204 IPGGLSLGQMLGNVNPRDFFTYRGSLTTPLCEQSVTWTVFSQVLPVPYSSVSKFWKLRDSEGHRL 268

  Fly   269 MQGSESTPKAPLGNNARPVQSLHHRTV 295
            :            ||.|.:|..:.|.|
  Fly   269 I------------NNFRDIQPRNGRPV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 81/277 (29%)
CAH6NP_001097987.1 Carb_anhydrase 30..282 CDD:215000 81/281 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.