DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and CAH4

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster


Alignment Length:267 Identity:71/267 - (26%)
Similarity:121/267 - (45%) Gaps:51/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 WNM-CNKGRRQSPIDV---------VPDKLLFDPYLR----PLHIDKHKVSGTLHNTGQSLVFRV 107
            ||: |  |.|||||.:         || ||.|..|.:    ||         ::.|.|.:::.|:
  Fly    30 WNVKC--GERQSPIALWSCNAITCNVP-KLKFLNYHKSLCDPL---------SVINNGLTVLMRI 82

  Fly   108 DKDTKQH-----VNISGGPLAYRYQFEEIYIHYGTENVRGSEHFIQGYSFPGEIQIYGFNKELYH 167
            .|.....     ::..|..:   ::.::::.|:|:...:||||.:.|..:.||:.|...|.. |.
  Fly    83 PKTVDGSRPSLCISTEGQQV---FEADQLHFHWGSALSKGSEHCLDGNYYDGEVHIVHKNAS-YK 143

  Fly   168 NMSEAQHKSQGIVGLSLMVQIGETPN---PELRIITSTFNKVLYRGFSTPIR-HISVRSLLPNTD 228
            :..||..:..|...|:|.::..|.||   |.:.:|....:.:.....|.|:. .::::.|..:.|
  Fly   144 SNKEAGLQPNGFAVLALFIRNLEDPNIETPAMNMICKQVSSITKLDDSCPLEDSMALQDLFASID 208

  Fly   229 --HYITYEGSTTHPGCWESTVWIIVNKPIYITKQ---ELYQLRRLMQGSESTPKAPLGNNARPVQ 288
              .|.||:||.|.|.|.|:.:|.:...|:.:.|:   ..:|||      :|..:..| |..|.:|
  Fly   209 SQKYFTYQGSLTTPPCAEAVIWFVFPTPLDVPKELWKHFWQLR------DSRDQRVL-NTYRELQ 266

  Fly   289 SLHHRTV 295
            ..|.|.|
  Fly   267 DGHDRPV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 71/267 (27%)
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 68/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.