DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and CAH8

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001262833.1 Gene:CAH8 / 42625 FlyBaseID:FBgn0038956 Length:303 Species:Drosophila melanogaster


Alignment Length:251 Identity:69/251 - (27%)
Similarity:118/251 - (47%) Gaps:30/251 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 GRRQSPIDVVPDK---LLFDPYLRPLHIDKHKVSGTLHNTGQSLVFRVDK---DTKQHVNISGGP 121
            |..||||.:...|   |...|.:..|:.:......|:.|:|.::.|:|..   ..|.:|  :||.
  Fly    45 GSEQSPIAISRRKAIPLNLPPLIFALYDEFFDELVTIRNSGHTVEFKVPTTIYGVKPYV--TGGL 107

  Fly   122 LAYRYQFEEIYIHYGTENVRGSEHFIQGYSFPGEIQIYGFNKELYHNMSEAQHKSQGIVGLSLMV 186
            |...|..|.::.|:|:...:||||.:.|..|..|:.|...|.: |.|:.||...|.|:..|:::.
  Fly   108 LRDCYDAEAVHFHWGSPESKGSEHLLNGRRFDLEMHIVHRNTK-YLNLEEAVKYSDGVTVLAVLF 171

  Fly   187 QIGET------PNPELRIITSTFNKVLYRG-FS---TPIRHISVRSLLPNTD--HYITYEGSTTH 239
            ::..:      |.     ::..|:.:|:.| |:   |....:::.|||.:.|  ::.||:||.|.
  Fly   172 KVVRSGPFFYQPG-----LSEIFSSLLHLGNFNASYTVQERLTLGSLLGSLDRGNFYTYKGSLTT 231

  Fly   240 PGCWESTVWIIVNKPIYITKQELYQLRRLMQGSESTPKAPLGNNARPVQSLHHRTV 295
            |.|.....|.:..:.:.|:.|:|.:...|    ......||..|.||:||..:|.:
  Fly   232 PPCSPVVQWHVFGEVLPISHQDLPKFWNL----RDERGRPLLKNFRPLQSQENRLI 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 69/251 (27%)
CAH8NP_001262833.1 Carb_anhydrase 31..281 CDD:215000 68/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.