DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPA and CAH7

DIOPT Version :9

Sequence 1:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001287267.1 Gene:CAH7 / 41238 FlyBaseID:FBgn0037788 Length:304 Species:Drosophila melanogaster


Alignment Length:294 Identity:84/294 - (28%)
Similarity:136/294 - (46%) Gaps:44/294 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IACSAIVLLCSSEVLSSWEEWWTY---DGISGPSFWGLINPQW-NMCNKGRRQSPIDVVP----- 73
            ||.|.||  |.| |..||...|.|   |......|     |:| .:|:.|::||||::..     
  Fly     4 IALSLIV--CCS-VSFSWANEWGYPDLDNNQDEPF-----PKWGGLCDSGKKQSPINLHVKGALK 60

  Fly    74 ---DKLLFDPYLRPLHIDKHKVSGTLHNTGQSLVFRVDKDTKQHVNISGGPLAYRYQFEEIYIHY 135
               |.|.|:.|      |:|:.:..:.|.|.|:..   ......:.:|||.|...:..|:|::|:
  Fly    61 GEFDALKFENY------DEHQKNLRMVNNGHSIQL---SGFDHELTLSGGALLQDFVVEQIHMHW 116

  Fly   136 GTENVRGSEHFIQGYSFPGEIQIYGFNKELYHNMSEAQHKSQGIVGLSLMVQIGETPNPELRIIT 200
                  .|||.|....:|.|:.|...| .:|.||:.|.:...|||.:.::..:..|||..:..|.
  Fly   117 ------WSEHTINDIRYPLEVHIVHRN-TIYPNMTMAANFKDGIVVIGVLYHVSNTPNEAIGSII 174

  Fly   201 STFNKV-LYRGFSTPI---RHISVRSLLPNTDHYITYEGSTTHPGCWESTVWIIVNKPIYITKQE 261
            .:...| .|...:.|:   ..::|..|:|:.::|.||.||.|.|.|.|:..||::.:...:|..:
  Fly   175 KSLGAVKSYDSMNKPVLVADSLAVDDLVPSVENYFTYAGSLTTPTCAEAVTWIVLTETFPVTLDQ 239

  Fly   262 LYQLRRLMQGSESTPKAPLGNNARPVQSLHHRTV 295
            :.:.:.:    |......|.||.|.:||.::|.|
  Fly   240 VNEFKEI----EYDEGKQLHNNYRELQSENNRAV 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 71/263 (27%)
CAH7NP_001287267.1 alpha_CA 45..269 CDD:238200 66/243 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.